GREM2 (NM_022469) Human Tagged ORF Clone

SKU
RC207388
GREM2 (Myc-DDK-tagged)-Human gremlin 2 (GREM2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GREM2
Synonyms CKTSF1B2; DAND3; PRDC; STHAG9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207388 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCTGGAAGCTTTCCCTGTCCTTGTTCATGGTGGCGGTGCTGGTGAAGGTGGCGGAAGCCCGGAAGA
ACCGGCCGGCGGGCGCCATCCACTCGCCTTACAAGGACGGCAGCAGCAACAACTCGGAGAGATGGCAGCA
CCAGATCAAGGAGGTACTGGCCTCCAGCCAGGAGGCCCTGGTGGTCACCGAGCGCAAGTACCTCAAGAGT
GACTGGTGCAAGACGCAGCCGCTGCGGCAGACGGTGAGCGAGGAGGGCTGCCGGAGCCGCACCATCCTCA
ACCGCTTCTGCTACGGCCAGTGCAACTCCTTCTACATCCCGCGGCACGTGAAGAAGGAGGAGGAGTCCTT
CCAGTCCTGCGCCTTCTGCAAGCCCCAGCGCGTCACCTCCGTCCTCGTGGAGCTCGAGTGCCCCGGCCTG
GACCCACCCTTCCGACTCAAGAAAATCCAGAAGGTGAAGCAGTGCCGGTGCATGTCCGTGAACCTGAGCG
ACTCGGACAAGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207388 protein sequence
Red=Cloning site Green=Tags(s)

MFWKLSLSLFMVAVLVKVAEARKNRPAGAIHSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKS
DWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGL
DPPFRLKKIQKVKQCRCMSVNLSDSDKQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_022469
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022469.2
RefSeq Size 4199 bp
RefSeq ORF 507 bp
Locus ID 64388
UniProt ID Q9H772
Cytogenetics 1q43
Domains CT, DAN
Protein Families Secreted Protein
MW 19.4 kDa
Summary This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GREM2 (NM_022469) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207388L1 Lenti ORF clone of Human gremlin 2 (GREM2), Myc-DDK-tagged 10 ug
$600.00
RC207388L2 Lenti ORF clone of Human gremlin 2 (GREM2), mGFP tagged 10 ug
$600.00
RC207388L3 Lenti ORF clone of Human gremlin 2 (GREM2), Myc-DDK-tagged 10 ug
$600.00
RC207388L4 Lenti ORF clone of Human gremlin 2 (GREM2), mGFP tagged 10 ug
$600.00
RG207388 GREM2 (tGFP-tagged) - Human gremlin 2 (GREM2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC127022 GREM2 (untagged)-Human gremlin 2 (GREM2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.