TMEM65 (NM_194291) Human Tagged ORF Clone

SKU
RC207368
TMEM65 (Myc-DDK-tagged)-Human transmembrane protein 65 (TMEM65)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMEM65
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207368 representing NM_194291
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCGGCTGCTGCGGCTGCTGAGGAGCCGGACCGCGCGCAGCCTGAGGCCGGGCCCGGCCGCCGCCG
CCGCGCCCCGCCCGCCGTCCTGGTGCTGCTGCGGGCGGGGGCTGCTGGCGCTCGCGCCCCCCGGCGGCTT
GCCGGGCGGCCCCAGGCGGCTGGGCACGCACCCCAAGAAGGAGCCCATGGAGGCGCTGAACACGGCGCAG
GGCGCGCGCGACTTCATCTACAGCCTGCACTCCACGGAGAGGAGCTGCCTGCTCAAAGAGCTGCACCGCT
TCGAGTCTGTTGCCATTGCCCAAGAAAAATTGGAAGCTCCACCACCCACCCCAGGACAGCTGAGATATGT
ATTCATCCACAATGCGATACCTTTCATAGGGTTTGGCTTTTTGGATAATGCAATTATGATTGTTGCTGGA
ACCCATATTGAAATGTCTATTGGAATTATTTTGGGAATTTCAACTATGGCAGCTGCTGCTTTGGGAAATC
TTGTGTCAGATCTAGCTGGACTTGGACTTGCAGGCTACGTTGAAGCATTGGCTTCCAGGTTAGGCCTGTC
AATTCCTGATCTCACACCAAAGCAAGTTGACATGTGGCAAACACGTCTTAGTACACATTTGGGCAAAGCT
GTTGGGGTGACTATTGGCTGCATTCTAGGAATGTTTCCTTTAATTTTCTTTGGAGGAGGTGAAGAAGATG
AAAAACTGGAAACGAAAAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207368 representing NM_194291
Red=Cloning site Green=Tags(s)

MSRLLRLLRSRTARSLRPGPAAAAAPRPPSWCCCGRGLLALAPPGGLPGGPRRLGTHPKKEPMEALNTAQ
GARDFIYSLHSTERSCLLKELHRFESVAIAQEKLEAPPPTPGQLRYVFIHNAIPFIGFGFLDNAIMIVAG
THIEMSIGIILGISTMAAAALGNLVSDLAGLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRLSTHLGKA
VGVTIGCILGMFPLIFFGGGEEDEKLETKS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_194291
ORF Size 720 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_194291.1, NP_919267.1
RefSeq Size 3258 bp
RefSeq ORF 723 bp
Locus ID 157378
UniProt ID Q6PI78
Cytogenetics 8q24.13
Protein Families Transmembrane
MW 25.3 kDa
Summary May play an important role in cardiac development and function. May regulate cardiac conduction and the function of the gap junction protein GJA1. May contributes to the stability and proper localization of GJA1 to cardiac intercalated disk thereby regulating gap junction communication (By similarity). May also play a role in the regulation of mitochondrial respiration and mitochondrial DNA copy number maintenance (PubMed:28295037).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:TMEM65 (NM_194291) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207368L1 Lenti-ORF clone of TMEM65 (Myc-DDK-tagged)-Human transmembrane protein 65 (TMEM65) 10 ug
$600.00
RC207368L2 Lenti-ORF clone of TMEM65 (mGFP-tagged)-Human transmembrane protein 65 (TMEM65) 10 ug
$600.00
RC207368L3 Lenti-ORF clone of TMEM65 (Myc-DDK-tagged)-Human transmembrane protein 65 (TMEM65) 10 ug
$600.00
RC207368L4 Lenti-ORF clone of TMEM65 (mGFP-tagged)-Human transmembrane protein 65 (TMEM65) 10 ug
$600.00
RG207368 TMEM65 (tGFP-tagged) - Human transmembrane protein 65 (TMEM65) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC107673 TMEM65 (untagged)-Human transmembrane protein 65 (TMEM65) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.