MXI1 (NM_130439) Human Tagged ORF Clone

SKU
RC207319
MXI1 (Myc-DDK-tagged)-Human MAX interactor 1 (MXI1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MXI1
Synonyms bHLHc11; MAD2; MXD2; MXI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207319 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAAACGCGGGCGGCCGCGCAAGGAGGCGCGCTGCGAGGGCGCGGGGCTGGCCCCCGCCGCGCCCC
CGGCTGTGCCCCCCGCCGTGGCCGCGCCCCAGCCCCCGGCCCTGCCCGAGGACCCCGCTGGGGCCAAGCC
CAGGTGCCCCTTCTCAGACATTTTCAACACCAGCGAGAACTCGATGGAGAAGCACATCAACACTTTTCTG
CAGAACGTGCAGATTCTGCTCGAGGCCGCCAGCTACCTGGAGCAGATCGAGAAAGAAAACAAAAAGTGTG
AACATGGCTACGCCTCTTCATTCCCGTCCATGCCGAGCCCCCGACTGCAGCATTCAAAGCCCCCACGGAG
GTTGAGCCGGGCACAGAAACACAGCAGCGGGAGCAGCAACACCAGCACTGCCAACAGATCTACACACAAT
GAGCTGGAAAAGAATCGACGAGCTCATCTGCGCCTTTGTTTAGAACGCTTAAAAGTTCTGATTCCACTAG
GACCAGACTGCACCCGGCACACAACACTTGGTTTGCTCAACAAAGCCAAAGCACACATCAAGAAACTTGA
AGAAGCTGAAAGAAAAAGCCAGCACCAGCTCGAGAATTTGGAACGAGAACAGAGATTTTTAAAGTGGCGA
CTGGAACAGCTGCAGGGTCCTCAGGAGATGGAACGAATACGAATGGACAGCATTGGATCAACTATTTCTT
CAGATCGTTCTGATTCAGAGCGAGAGGAGATTGAAGTGGATGTTGAAAGCACAGAGTTCTCCCATGGAGA
AGTGGACAATATAAGTACCACCAGCATCAGTGACATTGATGACCACAGCAGCCTGCCGAGTATTGGGAGT
GACGAGGGTTACTCCAGTGCCAGTGTCAAACTTTCATTCACTTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207319 protein sequence
Red=Cloning site Green=Tags(s)

MGKRGRPRKEARCEGAGLAPAAPPAVPPAVAAPQPPALPEDPAGAKPRCPFSDIFNTSENSMEKHINTFL
QNVQILLEAASYLEQIEKENKKCEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHN
ELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWR
LEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGS
DEGYSSASVKLSFTS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_130439
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_130439.3, NP_569157.2
RefSeq Size 3470 bp
RefSeq ORF 888 bp
Locus ID 4601
UniProt ID P50539
Cytogenetics 10q25.2
Domains HLH
Protein Families Druggable Genome, Transcription Factors
MW 32.8 kDa
Summary Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MXI1 (NM_130439) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207319L3 Lenti ORF clone of Human MAX interactor 1 (MXI1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC207319L4 Lenti ORF clone of Human MAX interactor 1 (MXI1), transcript variant 2, mGFP tagged 10 ug
$600.00
RG207319 MXI1 (tGFP-tagged) - Human MAX interactor 1 (MXI1), transcript variant 2 10 ug
$500.00
SC109464 MXI1 (untagged)-Human MAX interactor 1 (MXI1), transcript variant 2 10 ug
$300.00
SC317433 MXI1 (untagged)-Human MAX interactor 1 (MXI1), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.