CBLN4 (NM_080617) Human Tagged ORF Clone

SKU
RC207263
CBLN4 (Myc-DDK-tagged)-Human cerebellin 4 precursor (CBLN4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CBLN4
Synonyms CBLNL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207263 representing NM_080617
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTCCGGGCGCCGGGCGCTGTCCGCGGTGCCGGCCGTGCTGCTGGTCCTCACGCTGCCGGGGCTGC
CCGTCTGGGCACAGAACGACACGGAGCCCATCGTGCTGGAGGGCAAGTGTCTGGTGGTGTGCGACTCGAA
CCCGGCCACGGACTCCAAGGGCTCCTCTTCCTCCCCGCTGGGGATATCGGTCCGGGCGGCCAACTCCAAG
GTCGCCTTCTCGGCGGTGCGGAGCACCAACCACGAGCCATCCGAGATGAGCAACAAGACGCGCATCATTT
ACTTCGATCAGATCCTGGTGAATGTGGGTAATTTTTTCACATTGGAGTCTGTCTTTGTAGCACCAAGAAA
AGGAATTTACAGTTTCAGTTTTCACGTGATTAAAGTCTACCAGAGCCAAACTATCCAGGTTAACTTGATG
TTAAATGGAAAACCAGTAATATCTGCCTTTGCGGGGGACAAAGATGTTACTCGTGAAGCTGCCACGAATG
GTGTCCTGCTCTACCTAGATAAAGAGGATAAGGTTTACCTAAAACTGGAGAAAGGTAATTTGGTTGGAGG
CTGGCAGTATTCCACGTTTTCTGGCTTTCTGGTGTTCCCCCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207263 representing NM_080617
Red=Cloning site Green=Tags(s)

MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSK
VAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLM
LNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_080617
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080617.6
RefSeq Size 2573 bp
RefSeq ORF 606 bp
Locus ID 140689
UniProt ID Q9NTU7
Cytogenetics 20q13.2
Domains C1Q
Protein Families Secreted Protein
MW 21.6 kDa
Summary This gene encodes a member of a family of small secreted proteins containing C1Q domains. Members of this family are involved in regulation of neurexin signalling during synapse development. The mouse homolog of the protein encoded by this gene competes with netrin to bind to the deleted in colorectal cancer receptor. [provided by RefSeq, Aug 2012]
Write Your Own Review
You're reviewing:CBLN4 (NM_080617) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207263L1 Lenti ORF clone of Human cerebellin 4 precursor (CBLN4), Myc-DDK-tagged 10 ug
$600.00
RC207263L2 Lenti ORF clone of Human cerebellin 4 precursor (CBLN4), mGFP tagged 10 ug
$600.00
RC207263L3 Lenti ORF clone of Human cerebellin 4 precursor (CBLN4), Myc-DDK-tagged 10 ug
$600.00
RC207263L4 Lenti ORF clone of Human cerebellin 4 precursor (CBLN4), mGFP tagged 10 ug
$600.00
RG207263 CBLN4 (tGFP-tagged) - Human cerebellin 4 precursor (CBLN4) 10 ug
$500.00
SC120382 CBLN4 (untagged)-Human cerebellin 4 precursor (CBLN4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.