BID (NM_001196) Human Tagged ORF Clone

SKU
RC207261
BID (Myc-DDK-tagged)-Human BH3 interacting domain death agonist (BID), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BID
Synonyms FP497
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207261 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCAGCGGTGCTGGGGTCATGATGGCTCGGTGGGCAGCGAGGGGCCGGGCCGGCTGGAGGAGCACAG
TGCGGATTCTGTCGCCACTGGGACACTGTGAACCAGGAGTGAGTCGGAGCTGCCGCGCTGCCCAGGCCAT
GGACTGTGAGGTCAACAACGGTTCCAGCCTCAGGGATGAGTGCATCACAAACCTACTGGTGTTTGGCTTC
CTCCAAAGCTGTTCTGACAACAGCTTCCGCAGAGAGCTGGACGCACTGGGCCACGAGCTGCCAGTGCTGG
CTCCCCAGTGGGAGGGCTACGATGAGCTGCAGACTGATGGCAACCGCAGCAGCCACTCCCGCTTGGGAAG
AATAGAGGCAGATTCTGAAAGTCAAGAAGACATCATCCGGAATATTGCCAGGCACCTCGCCCAGGTCGGG
GACAGCATGGACCGTAGCATCCCTCCGGGCCTGGTGAACGGCCTGGCCCTGCAGCTCAGGAACACCAGCC
GGTCGGAGGAGGACCGGAACAGGGACCTGGCCACTGCCCTGGAGCAGCTGCTGCAGGCCTACCCTAGAGA
CATGGAGAAGGAGAAGACCATGCTGGTGCTGGCCCTGCTGCTGGCCAAGAAGGTGGCCAGTCAAACGCCG
TCCTTGCTCCGTGATGTCTTTCACACAACAGTGAACTTTATTAACCAGAACCTACGCACCTACGTGAGGA
GCTTAGCCAGAAATGGGATGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207261 protein sequence
Red=Cloning site Green=Tags(s)

MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAMDCEVNNGSSLRDECITNLLVFGF
LQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVG
DSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASQTP
SLLRDVFHTTVNFINQNLRTYVRSLARNGMD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001196
ORF Size 723 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 2217 bp
RefSeq ORF 588 bp
Locus ID 637
UniProt ID P55957
Cytogenetics 22q11.21
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Pathways in cancer, Viral myocarditis
MW 26.8 kDa
Summary This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2, and thus regulate apoptosis. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Aug 2020]
Write Your Own Review
You're reviewing:BID (NM_001196) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207261L3 Lenti ORF clone of Human BH3 interacting domain death agonist (BID), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC207261L4 Lenti ORF clone of Human BH3 interacting domain death agonist (BID), transcript variant 2, mGFP tagged 10 ug
$600.00
RG207261 BID (tGFP-tagged) - Human BH3 interacting domain death agonist (BID), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC125311 BID (untagged)-Human BH3 interacting domain death agonist (BID), transcript variant 2 10 ug
$300.00
SC322103 BID (untagged)-Human BH3 interacting domain death agonist (BID), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.