LYPD6B (NM_177964) Human Tagged ORF Clone

SKU
RC207249
LYPD6B (Myc-DDK-tagged)-Human LY6/PLAUR domain containing 6B (LYPD6B)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LYPD6B
Synonyms CT116; LYPD7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207249 representing NM_177964
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCTGATTACTCTGAGTGCAAACCTTTTCACTGTTCCAGAGAGGAGCCTGACAACCACATTCTCCT
TCTCAAGATATAAGAGTTCGGACCGCCCAGCACACAAGGTCAGCATGCTGCTCCTCTGTCACGCTCTCGC
TATAGCTGTTGTCCAGATCGTTATCTTCTCAGAAAGCTGGGCATTTGCCAAGAACATCAACTTCTATAAT
GTGAGGCCTCCTCTCGACCCTACACCATTTCCAAATAGCTTCAAGTGCTTTACTTGTGAAAACGCAGGGG
ATAATTATAACTGCAATCGATGGGCAGAAGACAAATGGTGTCCACAAAATACACAGTACTGTTTGACAGT
TCATCACTTCACCAGCCACGGAAGAAGCACATCCATCACCAAAAAGTGTGCCTCCAGAAGTGAATGTCAT
TTTGTCGGTTGCCACCACAGCCGAGATTCTGAACATACGGAGTGTAGGTCTTGCTGTGAAGGAATGATCT
GCAATGTAGAATTACCCACCAATCACACTAATGCAGTGTTTGCCGTAATGCACGCTCAGAGAACATCTGG
CAGCAGTGCCCCCACACTCTACCTACCAGTGCTTGCCTGGGTCTTTGTGCTTCCATTGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207249 representing NM_177964
Red=Cloning site Green=Tags(s)

MLLITLSANLFTVPERSLTTTFSFSRYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYN
VRPPLDPTPFPNSFKCFTCENAGDNYNCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECH
FVGCHHSRDSEHTECRSCCEGMICNVELPTNHTNAVFAVMHAQRTSGSSAPTLYLPVLAWVFVLPLL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_177964
ORF Size 621 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177964.5
RefSeq Size 1600 bp
RefSeq ORF 624 bp
Locus ID 130576
UniProt ID Q8NI32
Cytogenetics 2q23.2
Protein Families Druggable Genome, Transmembrane
MW 23.2 kDa
Summary Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro acts on nAChRs in a subtype- and stoichiometry-dependent manner. Modulates specifically alpha-3(3):beta-4(2) nAChRs by enhancing the sensitivity to ACh, decreasing ACh-induced maximal current response and increasing the rate of desensitization to ACh; has no effect on alpha-7 homomeric nAChRs; modulates alpha-3(2):alpha-5:beta-4(2) nAChRs in the context of CHRNA5/alpha-5 variant Asn-398 but not its wild-type sequence.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LYPD6B (NM_177964) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207249L3 Lenti ORF clone of Human LY6/PLAUR domain containing 6B (LYPD6B), Myc-DDK-tagged 10 ug
$600.00
RC207249L4 Lenti ORF clone of Human LY6/PLAUR domain containing 6B (LYPD6B), mGFP tagged 10 ug
$600.00
RG207249 LYPD6B (tGFP-tagged) - Human LY6/PLAUR domain containing 6B (LYPD6B) 10 ug
$500.00
SC107028 LYPD6B (untagged)-Human LY6/PLAUR domain containing 6B (LYPD6B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.