LYRIC (MTDH) (NM_178812) Human Tagged ORF Clone

CAT#: RC207238

Reviews ()
Write a review

MTDH (Myc-DDK-tagged)-Human metadherin (MTDH)



  "NM_178812" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MTDH
Synonyms 3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207238 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCACGGAGCTGGCAGGACGAGCTGGCCCAGCAGGCCGAGGAGGGCTCGGCCCGGCTGCGGGAAA
TGCTCTCGGTCGGCCTAGGCTTTCTGCGCACCGAGCTGGGCCTCGACCTGGGGCTGGAGCCGAAACGGTA
CCCCGGCTGGGTGATCCTGGTGGGCACTGGCGCGCTCGGGCTGCTGCTGCTGTTTCTGCTGGGCTACGGC
TGGGCCGCGGCTTGCGCCGGCTCCCGCAAAAAGCGGAGGAGCCCGCCCCGCAAGCGGGAGGAGGCGGCGG
CCGTGCCGGCCGCGGCCCCCGACGACCTGGCCTTGCTGAAGAATCTCCGGAGCGAGGAACAGAAGAAGAA
GAACCGGAAGAAACTGTCCGAGAAGCCCAAACCAAATGGGCGGACTGTTGAAGTGGCTGAGGGTGAAGCT
GTTCGAACACCTCAAAGTGTAACAGCAAAGCAGCCACCAGAGATTGACAAGAAAAATGAAAAGTCAAAGA
AAAATAAGAAGAAATCAAAGTCAGATGCTAAAGCAGTGCAAAACAGTTCACGCCATGATGGAAAGGAAGT
TGATGAAGGAGCCTGGGAAACTAAAATTAGTCACAGAGAGAAACGACAGCAGCGTAAACGTGATAAGGTG
CTGACTGATTCTGGTTCATTGGATTCAACTATCCCTGGGATAGAAAATACCATCACAGTTACCACCGAGC
AACTTACAACCGCATCATTTCCTGTTGGTTCCAAGAAGAATAAAGGTGATTCTCATCTAAATGTTCAAGT
TAGCAACTTTAAATCTGGAAAAGGAGATTCTACACTTCAGGTTTCTTCAGGATTGAATGAAAACCTCACT
GTCAATGGAGGAGGCTGGAATGAAAAGTCTGTAAAACTCTCCTCACAGATCAGTGCAGGTGAGGAGAAGT
GGAACTCCGTTTCACCTGCTTCTGCAGGAAAGAGGAAAGCTGAGCCATCTGCCTGGAGTCAAGACACTGG
AGATGCTAATACAAATGGAAAAGACTGGGGAAGGAGTTGGAGTGACCGTTCAATATTTTCTGGCATTGGG
TCTACTGCTGAGCCAGTTTCTCAGTCTACCACTTCTGATTATCAGTGGGATGTTAGCCGTAATCAACCCT
ATATCGATGATGAATGGTCTGGGTTAAATGGTCTGTCTTCTGCTGATCCCAACTCTGATTGGAATGCACC
AGCAGAAGAGTGGGGCAATTGGGTAGACGAAGAAAGAGCTTCACTTCTAAAGTCCCAGGAACCAATTCCT
GATGATCAAAAGGTCTCAGATGATGATAAAGAAAAGGGAGAGGGAGCTCTTCCAACTGGGAAATCCAAAA
AGAAAAAAAAGAAAAAGAAGAAGCAAGGTGAAGATAACTCTACTGCACAGGACACAGAAGAATTAGAAAA
AGAGATTAGAGAAGACCTTCCAGTGAATACCTCTAAAACCCGTCCAAAACAGGAAAAAGCTTTTTCCTTG
AAGACCATAAGCACTAGTGATCCAGCCGAAGTACTCGTCAAAAATAGCCAGCCTATCAAGACTCTTCCAC
CTGCTACTTCTACCGAGCCATCTGTAATCTTATCAAAAAGTGATTCTGACAAGAGCTCTTCCCAAGTGCC
GCCAATACTACAAGAGACAGATAAATCCAAGTCAAATACCAAGCAAAATAGTGTGCCTCCTTCACAGACC
AAGTCTGAAACTAGCTGGGAATCTCCCAAACAAATAAAAAAGAAGAAAAAAGCCAGACGAGAAACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207238 protein sequence
Red=Cloning site Green=Tags(s)

MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYG
WAAACAGSRKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEA
VRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKV
LTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLT
VNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKAEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIG
STAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIP
DDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSL
KTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQT
KSETSWESPKQIKKKKKARRET

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_178812
ORF Size 1746 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_178812.2, NP_848927.1
RefSeq Size 7667 bp
RefSeq ORF 1749 bp
Locus ID 92140
UniProt ID Q86UE4
Cytogenetics 8q22.1
Protein Families Transmembrane
MW 63.8 kDa
Gene Summary Downregulates SLC1A2/EAAT2 promoter activity when expressed ectopically. Activates the nuclear factor kappa-B (NF-kappa-B) transcription factor. Promotes anchorage-independent growth of immortalized melanocytes and astrocytes which is a key component in tumor cell expansion. Promotes lung metastasis and also has an effect on bone and brain metastasis, possibly by enhancing the seeding of tumor cells to the target organ endothelium. Induces chemoresistance.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "MTDH"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


MTDH mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.