LYRIC(MTDH) (NM_178812) Human Tagged ORF Clone

CAT#: RG207238

MTDH (GFP-tagged) - Human metadherin (MTDH)

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name LYRIC(MTDH) (NM_178812) Human Tagged ORF Clone
Symbol MTDH
Synonyms 3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG207238 representing NM_178812
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCACGGAGCTGGCAGGACGAGCTGGCCCAGCAGGCCGAGGAGGGCTCGGCCCGGCTGCGGGAAA
TGCTCTCGGTCGGCCTAGGCTTTCTGCGCACCGAGCTGGGCCTCGACCTGGGGCTGGAGCCGAAACGGTA
CCCCGGCTGGGTGATCCTGGTGGGCACTGGCGCGCTCGGGCTGCTGCTGCTGTTTCTGCTGGGCTACGGC
TGGGCCGCGGCTTGCGCCGGCTCCCGCAAAAAGCGGAGGAGCCCGCCCCGCAAGCGGGAGGAGGCGGCGG
CCGTGCCGGCCGCGGCCCCCGACGACCTGGCCTTGCTGAAGAATCTCCGGAGCGAGGAACAGAAGAAGAA
GAACCGGAAGAAACTGTCCGAGAAGCCCAAACCAAATGGGCGGACTGTTGAAGTGGCTGAGGGTGAAGCT
GTTCGAACACCTCAAAGTGTAACAGCAAAGCAGCCACCAGAGATTGACAAGAAAAATGAAAAGTCAAAGA
AAAATAAGAAGAAATCAAAGTCAGATGCTAAAGCAGTGCAAAACAGTTCACGCCATGATGGAAAGGAAGT
TGATGAAGGAGCCTGGGAAACTAAAATTAGTCACAGAGAGAAACGACAGCAGCGTAAACGTGATAAGGTG
CTGACTGATTCTGGTTCATTGGATTCAACTATCCCTGGGATAGAAAATACCATCACAGTTACCACCGAGC
AACTTACAACCGCATCATTTCCTGTTGGTTCCAAGAAGAATAAAGGTGATTCTCATCTAAATGTTCAAGT
TAGCAACTTTAAATCTGGAAAAGGAGATTCTACACTTCAGGTTTCTTCAGGATTGAATGAAAACCTCACT
GTCAATGGAGGAGGCTGGAATGAAAAGTCTGTAAAACTCTCCTCACAGATCAGTGCAGGTGAGGAGAAGT
GGAACTCCGTTTCACCTGCTTCTGCAGGAAAGAGGAAAGCTGAGCCATCTGCCTGGAGTCAAGACACTGG
AGATGCTAATACAAATGGAAAAGACTGGGGAAGGAGTTGGAGTGACCGTTCAATATTTTCTGGCATTGGG
TCTACTGCTGAGCCAGTTTCTCAGTCTACCACTTCTGATTATCAGTGGGATGTTAGCCGTAATCAACCCT
ATATCGATGATGAATGGTCTGGGTTAAATGGTCTGTCTTCTGCTGATCCCAACTCTGATTGGAATGCACC
AGCAGAAGAGTGGGGCAATTGGGTAGACGAAGAAAGAGCTTCACTTCTAAAGTCCCAGGAACCAATTCCT
GATGATCAAAAGGTCTCAGATGATGATAAAGAAAAGGGAGAGGGAGCTCTTCCAACTGGGAAATCCAAAA
AGAAAAAAAAGAAAAAGAAGAAGCAAGGTGAAGATAACTCTACTGCACAGGACACAGAAGAATTAGAAAA
AGAGATTAGAGAAGACCTTCCAGTGAATACCTCTAAAACCCGTCCAAAACAGGAAAAAGCTTTTTCCTTG
AAGACCATAAGCACTAGTGATCCAGCCGAAGTACTCGTCAAAAATAGCCAGCCTATCAAGACTCTTCCAC
CTGCTACTTCTACCGAGCCATCTGTAATCTTATCAAAAAGTGATTCTGACAAGAGCTCTTCCCAAGTGCC
GCCAATACTACAAGAGACAGATAAATCCAAGTCAAATACCAAGCAAAATAGTGTGCCTCCTTCACAGACC
AAGTCTGAAACTAGCTGGGAATCTCCCAAACAAATAAAAAAGAAGAAAAAAGCCAGACGAGAAACG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207238 representing NM_178812
Red=Cloning site Green=Tags(s)

MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYG
WAAACAGSRKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEA
VRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKV
LTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLT
VNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKAEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIG
STAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIP
DDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSL
KTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQT
KSETSWESPKQIKKKKKARRET

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_178812
ORF Size 1746 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_178812.2, NP_848927
RefSeq Size 3729
Locus ID 92140
Cytogenetics 8q22.1
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations