ULBP1 (NM_025218) Human Tagged ORF Clone

SKU
RC207174
ULBP1 (Myc-DDK-tagged)-Human UL16 binding protein 1 (ULBP1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ULBP1
Synonyms N2DL-1; NKG2DL1; RAET1I
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207174 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCGGCCGCCAGCCCCGCGTTCCTTCTGTGCCTCCCGCTTCTGCACCTGCTGTCTGGCTGGTCCC
GGGCAGGATGGGTCGACACACACTGTCTTTGCTATGACTTCATCATCACTCCTAAGTCCAGACCTGAACC
ACAGTGGTGTGAAGTTCAAGGCCTGGTGGATGAAAGGCCTTTTCTTCACTATGACTGTGTTAACCACAAG
GCCAAAGCCTTTGCTTCTCTGGGGAAGAAAGTCAATGTCACAAAAACCTGGGAAGAACAAACTGAAACAC
TAAGAGACGTGGTGGATTTCCTTAAAGGGCAACTGCTTGACATTCAAGTGGAGAATTTAATACCCATTGA
GCCCCTCACCCTGCAGGCCAGGATGTCTTGTGAGCATGAAGCCCATGGACACGGCAGAGGATCTTGGCAG
TTCCTCTTCAATGGACAGAAGTTCCTCCTCTTTGACTCAAACAACAGAAAGTGGACAGCACTTCATCCTG
GAGCCAAGAAGATGACAGAGAAGTGGGAGAAGAACAGGGATGTGACCATGTTCTTCCAGAAGATTTCACT
GGGGGATTGTAAGATGTGGCTTGAAGAATTTTTGATGTACTGGGAACAAATGCTGGATCCAACAAAACCA
CCCTCTCTGGCCCCAGGCACAACCCAACCCAAGGCCATGGCCACCACCCTCAGTCCCTGGAGCCTTCTCA
TCATCTTCCTCTGCTTCATTCTAGCTGGCAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207174 protein sequence
Red=Cloning site Green=Tags(s)

MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHK
AKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQ
FLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKP
PSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_025218
ORF Size 732 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025218.4
RefSeq Size 3160 bp
RefSeq ORF 735 bp
Locus ID 80329
UniProt ID Q9BZM6
Cytogenetics 6q25.1
Protein Families Druggable Genome, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity
MW 28 kDa
Summary The protein encoded by this gene is a ligand of natural killer group 2, member D (NKG2D), an immune system-activating receptor on NK cells and T-cells. Binding of the encoded ligand to NKG2D leads to activation of several signal transduction pathways, including those of JAK2, STAT5, ERK and PI3K kinase/Akt. Also, in cytomegalovirus-infected cells, this ligand binds the UL16 glycoprotein and is prevented from activating the immune system. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:ULBP1 (NM_025218) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207174L1 Lenti ORF clone of Human UL16 binding protein 1 (ULBP1), Myc-DDK-tagged 10 ug
$600.00
RC207174L2 Lenti ORF clone of Human UL16 binding protein 1 (ULBP1), mGFP tagged 10 ug
$600.00
RC207174L3 Lenti ORF clone of Human UL16 binding protein 1 (ULBP1), Myc-DDK-tagged 10 ug
$600.00
RC207174L4 Lenti ORF clone of Human UL16 binding protein 1 (ULBP1), mGFP tagged 10 ug
$600.00
RG207174 ULBP1 (tGFP-tagged) - Human UL16 binding protein 1 (ULBP1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC305245 ULBP1 (untagged)-Human UL16 binding protein 1 (ULBP1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.