OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPBAR1 (NM_001077191) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207164
GPBAR1 (Myc-DDK-tagged)-Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA336959 Rabbit Polyclonal TGR5/GPBAR1 Antibody
100 ul
$730.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GPBAR1 or NM_001077191"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GPBAR1
Synonyms BG37; GPCR19; GPR131; M-BAR; TGR5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207164 representing NM_001077191.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGACGCCCAACAGCACTGGCGAGGTGCCCAGCCCCATTCCCAAGGGGGCTTTGGGGCTCTCCCTGGCC
CTGGCAAGCCTCATCATCACCGCGAACCTGCTCCTAGCCCTGGGCATCGCCTGGGACCGCCGCCTGCGC
AGCCCACCTGCTGGCTGCTTCTTCCTGAGCCTACTGCTGGCTGGGCTGCTCACGGGTCTGGCATTGCCC
ACATTGCCAGGGCTGTGGAACCAGAGTCGCCGGGGTTACTGGTCCTGCCTCCTCGTCTACTTGGCTCCC
AACTTCTCCTTCCTCTCCCTGCTTGCCAACCTCTTGCTGGTGCACGGGGAGCGCTACATGGCAGTCCTG
AGGCCACTCCAGCCCCCTGGGAGCATTCGGCTGGCCCTGCTCCTCACCTGGGCTGGTCCCCTGCTCTTT
GCCAGTCTGCCCGCTCTTGGGTGGAACCACTGGACCCCTGGTGCCAACTGCAGCTCCCAGGCTATCTTC
CCAGCCCCCTACCTGTACCTCGAAGTCTATGGGCTCCTGCTGCCCGCCGTGGGTGCTGCTGCCTTCCTC
TCTGTCCGCGTGCTGGCCACTGCCCACCGCCAGCTGCAGGACATCTGCCGGCTGGAGCGGGCAGTGTGC
CGCGATGAGCCCTCCGCCCTGGCCCGGGCCCTTACCTGGAGGCAGGCAAGGGCACAGGCTGGAGCCATG
CTGCTCTTCGGGCTGTGCTGGGGGCCCTACGTGGCCACACTGCTCCTCTCAGTCCTGGCCTATGAGCAG
CGCCCGCCACTGGGGCCTGGGACACTGTTGTCCCTCCTCTCCCTAGGAAGTGCCAGTGCAGCGGCAGTG
CCCGTAGCCATGGGGCTGGGCGATCAGCGCTACACAGCCCCCTGGAGGGCAGCCGCCCAAAGGTGCCTG
CAGGGGCTGTGGGGAAGAGCCTCCCGGGACAGTCCCGGCCCCAGCATTGCCTACCACCCAAGCAGCCAA
AGCAGTGTCGACCTGGACTTGAAC
ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC207164
Blue=ORF Red=Cloning site Green=Tag(s)

MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALP
TLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLF
ASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVC
RDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAV
PVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN
myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001077191
ORF Size 990 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 2023 bp
RefSeq ORF 993 bp
Locus ID 151306
UniProt ID Q8TDU6
Cytogenetics 2q35
Protein Families Druggable Genome
MW 35.2 kDa
Summary This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids. Alternative splicing results in multiple transcript variants encoding the same protein. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001077191" in other vectors (6)
SKU Description Size Price
RC207164L1 Lenti ORF clone of Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207164L2 Lenti ORF clone of Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC207164L3 Lenti ORF clone of Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207164L4 Lenti ORF clone of Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG207164 GPBAR1 (tGFP-tagged) - Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 1 10 ug
$489.00 $500.00
SC323958 GPBAR1 (untagged)-Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 1 10 ug
$300.00

Plasmid Map for RC207164

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC207164
Circular map for RC207164

file-alt Citations

Bile Acids Gate Dopamine Transporter Mediated Currents
Romanazzi, Zanella, Cheng et al
Front Chem (2021) 9, 753990 DOI: 10.3389/fchem.2021.753990
Cited by 10
AI Summary: In this study, the researchers used the OriGene murine DAT (mDAT) cDNA (Cat# MC202633) to express functional dopamine transporters in Xenopus laevis oocytes, enabling them to investigate how bile acids, specifically obeticholic acid, regulate DAT-mediated currents.
FigureFigureFigure
Ursolic acid activates the TGR5 receptor to enhance GLP-1 secretion in type 1-like diabetic rats
Lo, Li, Cheng et al
Naunyn Schmiedebergs Arch. Pharmacol. (2017)
AI Summary: OriGene’s GPBAR1 Human cDNA ORF Clone (NM_001077191) was used to transfect CHO-K1 cells with the TGR5 gene, enabling the study of ursolic acid’s effect on TGR5 activation and glucose metabolism in this research.
Snippet: According to our previous method (Lo et al. 2016), CHO-K1 cells were transiently transfected with human TGR5 receptor expression vector (GPBAR1 Human cDNA ORF Clone, NM_001077191;Origene Technologies, Inc., Rockville, MD, USA). ... All 3 versions Cite SaveSaving
Investigation of triamterene as an inhibitor of the TGR5 receptor: identification in cells and animals
Li, Cheng, Niu et al
Drug Des Devel Ther (2017) 11, 1127-1134 DOI: 10.2147/DDDT.S131892
AI Summary: OriGene’s pCMV6-Entry vector containing the human GPBAR1 gene was used to transfect CHO-K1 cells, enabling the study of triamterene as a TGR5 receptor inhibitor in this research.
Snippet: The CHO-K1 cells were transfected with the human GPBAR1 gene that had been cloned into an expression vector (pCMV6-Entry;OriGene, Rockville, MD, USA).22 One day later, successful transfection was confirmed using Western blotting using the method described ... All 2 versions Cite SaveSaving
FigureFigureFigure
TGR5 activation suppressed S1P/S1P2 signaling and resisted high glucose-induced fibrosis in glomerular mesangial cells
Yang, Xiong, Wang et al
Pharmacol. Res. (2016) 111, 226-236 DOI: 10.1016/j.phrs.2016.05.035
Cited by 48
AI Summary: OriGene's TGR5 overexpression plasmids were used in this study to investigate the effects of TGR5 activation on high glucose-induced fibrosis in glomerular mesangial cells.
Snippet: 2.3. Plasmids, small-interfering RNAs and transient transfection. TGR5 plasmids for overexpression were purchased from OriGene Technologies (OriGene, USA). pAP-1-Luc reporter gene plasmids were purchased from Beyotime (Haimen, China). ... Cite SaveSaving
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products