TIRAP (NM_001039661) Human Tagged ORF Clone

SKU
RC207162
TIRAP (Myc-DDK-tagged)-Human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TIRAP
Synonyms BACTS1; Mal; MyD88-2; wyatt
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207162 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATCATCGACCTCCCTCCCAGCTCCTGGCTCTCGGCCTAAGAAGCCTCTAGGCAAGATGGCTGACT
GGTTCAGGCAGACCCTGCTGAAGAAGCCCAAGAAGAGGCCCAACTCCCCAGAAAGCACCTCCAGCGATGC
TTCACAGCCTACCTCACAGGACAGCCCACTACCCCCAAGCCTCAGCTCAGTCACGTCTCCCAGCCTGCCA
CCCACACATGCGAGTGACAGTGGCAGTAGTCGCTGGAGCAAAGACTATGACGTCTGCGTGTGCCACAGTG
AGGAAGACCTGGTGGCCGCCCAGGACCTGGTCTCCTACTTGGAAGGCAGCACTGCCAGCCTGCGCTGCTT
CCTGCAACTCCGGGATGCAACCCCAGGCGGCGCTATAGTGTCCGAGCTGTGCCAGGCACTGAGCAGTAGT
CACTGCCGGGTGCTGCTCATCACGCCGGGCTTCCTTCAGGACCCCTGGTGCAAGTACCAGATGCTGCAGG
CCCTGACCGAGGCTCCAGGGGCCGAGGGCTGCACCATCCCCCTGCTGTCGGGCCTCAGCAGAGCTGCCTA
CCCACCTGAGCTCCGATTCATGTACTACGTCGATGGCAGGGGCCCTGATGGTGGCTTTCGTCAAGTCAAA
GAAGCTGTCATGCGTTATCTGCAGACACTCAGTTGGCACTTGTTATATCATGGGACCCCGGAAATTGGAG
TGAAGCTAGAAACAGAAAACCCATGCAGGGCCTCGGATTCCCACAAATGTGACAAGAGGTATAGGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207162 protein sequence
Red=Cloning site Green=Tags(s)

MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLP
PTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSS
HCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVK
EAVMRYLQTLSWHLLYHGTPEIGVKLETENPCRASDSHKCDKRYRE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001039661
ORF Size 768 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 2348 bp
RefSeq ORF 666 bp
Locus ID 114609
UniProt ID P58753
Cytogenetics 11q24.2
Protein Families Druggable Genome
Protein Pathways Toll-like receptor signaling pathway
MW 28 kDa
Summary The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleukin 1 receptor (TIR) domain, which is responsible for signal transduction. The protein encoded by this gene is a TIR adaptor protein involved in the TLR4 signaling pathway of the immune system. It activates NF-kappa-B, MAPK1, MAPK3 and JNK, which then results in cytokine secretion and the inflammatory response. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TIRAP (NM_001039661) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207162L1 Lenti ORF clone of Human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC207162L2 Lenti ORF clone of Human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3, mGFP tagged 10 ug
$600.00
RC207162L3 Lenti ORF clone of Human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC207162L4 Lenti ORF clone of Human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3, mGFP tagged 10 ug
$600.00
RG207162 TIRAP (tGFP-tagged) - Human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC324197 TIRAP (untagged)-Human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.