Myotrophin (MTPN) (NM_145808) Human Tagged ORF Clone
SKU
RC207133
MTPN (Myc-DDK-tagged)-Human myotrophin (MTPN)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | Myotrophin |
Synonyms | GCDP; V-1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC207133 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGCGACAAGGAGTTCATGTGGGCCCTGAAAAACGGAGACTTGGATGAGGTGAAAGACTATGTGGCCA AGGGAGAAGATGTCAACCGGACACTAGAAGGTGGAAGGAAACCTCTTCATTATGCAGCAGATTGTGGGCA GCTTGAAATCCTGGAATTTCTGCTGCTGAAAGGAGCAGATATTAATGCTCCAGATAAACATCATATTACT CCTCTTCTGTCTGCTGTCTATGAGGGTCATGTTTCCTGTGTGAAATTGCTTCTGTCAAAGGGTGCTGATA AGACTGTGAAAGGCCCAGATGGACTGACCGCCTTTGAAGCCACTGACAACCAGGCAATCAAAGCTCTTCT CCAG AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207133 protein sequence
Red=Cloning site Green=Tags(s) MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHIT PLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-RsrII Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_145808 |
ORF Size | 354 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_145808.4 |
RefSeq Size | 3900 bp |
RefSeq ORF | 357 bp |
Locus ID | 136319 |
UniProt ID | P58546 |
Cytogenetics | 7q33 |
Domains | ANK |
MW | 12.9 kDa |
Summary | The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC207133L3 | Lenti ORF clone of Human myotrophin (MTPN), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC207133L4 | Lenti ORF clone of Human myotrophin (MTPN), mGFP tagged | 10 ug |
$450.00
|
|
RG207133 | MTPN (tGFP-tagged) - Human myotrophin (MTPN) | 10 ug |
$489.00
|
|
SC100218 | MTPN (untagged)-Human myotrophin (MTPN) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.