Myotrophin (MTPN) (NM_145808) Human Tagged ORF Clone

SKU
RC207133
MTPN (Myc-DDK-tagged)-Human myotrophin (MTPN)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Myotrophin
Synonyms GCDP; V-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207133 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCGACAAGGAGTTCATGTGGGCCCTGAAAAACGGAGACTTGGATGAGGTGAAAGACTATGTGGCCA
AGGGAGAAGATGTCAACCGGACACTAGAAGGTGGAAGGAAACCTCTTCATTATGCAGCAGATTGTGGGCA
GCTTGAAATCCTGGAATTTCTGCTGCTGAAAGGAGCAGATATTAATGCTCCAGATAAACATCATATTACT
CCTCTTCTGTCTGCTGTCTATGAGGGTCATGTTTCCTGTGTGAAATTGCTTCTGTCAAAGGGTGCTGATA
AGACTGTGAAAGGCCCAGATGGACTGACCGCCTTTGAAGCCACTGACAACCAGGCAATCAAAGCTCTTCT
CCAG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207133 protein sequence
Red=Cloning site Green=Tags(s)

MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHIT
PLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_145808
ORF Size 354 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145808.4
RefSeq Size 3900 bp
RefSeq ORF 357 bp
Locus ID 136319
UniProt ID P58546
Cytogenetics 7q33
Domains ANK
MW 12.9 kDa
Summary The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Myotrophin (MTPN) (NM_145808) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207133L3 Lenti ORF clone of Human myotrophin (MTPN), Myc-DDK-tagged 10 ug
$450.00
RC207133L4 Lenti ORF clone of Human myotrophin (MTPN), mGFP tagged 10 ug
$450.00
RG207133 MTPN (tGFP-tagged) - Human myotrophin (MTPN) 10 ug
$489.00
SC100218 MTPN (untagged)-Human myotrophin (MTPN) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.