MRPS11 (NM_022839) Human Tagged ORF Clone

  • Product Brand Image
SKU
RC207075
MRPS11 (Myc-DDK-tagged)-Human mitochondrial ribosomal protein S11 (MRPS11), nuclear gene encoding mitochondrial protein, transcript variant 1
  $300.00
In Stock*
Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MRPS11
Synonyms HCC-2; MRP-S11; S11mt
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207075 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCTGTGAGAAACGCGGGGTCGCGGTTCCTGCGGTCCTGGACTTGGCCCCAGACAGCCGGCAGGG
TCGTGGCCAGAACGCCGGCCGGGACCATCTGCACAGGCGCTCGACAGCTCCAAGACGCTGCGGCCAAGCA
GAAAGTTGAACAGAACGCGGCTCCCAGCCACACCAAGTTCAGCATTTACCCTCCCATTCCAGGAGAGGAG
AGCTCTCTGAGGTGGGCAGGAAAGAAATTTGAGGAGATCCCAATTGCACACATTAAAGCATCCCACAACA
ACACACAGATCCAGGTAGTCTCTGCTAGTAATGAGCCCCTTGCCTTTGCTTCCTGTGGCACAGAGGGATT
TCGGAATGCCAAGAAGGGCACAGGCATCGCAGCACAGACAGCAGGCATAGCCGCAGCGGCGAGAGCTAAA
CAAAAGGGCGTGATCCACATCCGAGTTGTGGTGAAAGGCCTGGGGCCAGGACGCTTGTCTGCCATGCACG
GACTGATCATGGGCGGCCTGGAAGTGATCTCAATCACAGACAACACCCCAATCCCACACAACGGCTGCCG
CCCCAGGAAGGCTCGGAAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207075 protein sequence
Red=Cloning site Green=Tags(s)

MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEE
SSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAK
QKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_022839
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022839.5
RefSeq Size 1501 bp
RefSeq ORF 585 bp
Locus ID 64963
UniProt ID P82912
Cytogenetics 15q25.3
Domains Ribosomal_S11
MW 20.6 kDa
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Apr 2016
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_022839" in other vectors (5)
SKU Description Size Price
RC207075L3 Lenti ORF clone of Human mitochondrial ribosomal protein S11 (MRPS11), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207075L4 Lenti ORF clone of Human mitochondrial ribosomal protein S11 (MRPS11), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged 10 ug
$600.00
RG207075 MRPS11 (tGFP-tagged) - Human mitochondrial ribosomal protein S11 (MRPS11), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$489.00 $500.00
SC112383 MRPS11 (untagged)-Human mitochondrial ribosomal protein S11 (MRPS11), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$300.00
SC323953 MRPS11 (untagged)-Human mitochondrial ribosomal protein S11 (MRPS11), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.