CXCR1 (NM_000634) Human Tagged ORF Clone

SKU
RC207019
CXCR1 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) receptor 1 (CXCR1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CXCR1
Synonyms C-C; C-C-CKR-1; CD128; CD181; CDw128a; CKR-1; CMKAR1; IL8R1; IL8RA; IL8RBA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207019 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAAATATTACAGATCCACAGATGTGGGATTTTGATGATCTAAATTTCACTGGCATGCCACCTGCAG
ATGAAGATTACAGCCCCTGTAGGCTAGAAACTGAGACACTCAACAAGTATGTTGTGATCATCGCCTATGC
CCTAGTGTTCCTGCTGAGCCTGCTGGGAAACTCCCTGGTGATGCTGGTCATCTTATACAGCAGGGTCGGC
CGCTCCGTCACTGATGTCTACCTGCTGAACCTGGCCTTGGCCGACCTACTCTTTGCCCTGACCTTGCCCA
TCTGGGCCGCCTCCAAGGTGAATGGCTGGATTTTTGGCACATTCCTGTGCAAGGTGGTCTCACTCCTGAA
GGAAGTCAACTTCTACAGTGGCATCCTGCTGTTGGCCTGCATCAGTGTGGACCGTTACCTGGCCATTGTC
CATGCCACACGCACACTGACCCAGAAGCGTCACTTGGTCAAGTTTGTTTGTCTTGGCTGCTGGGGACTGT
CTATGAATCTGTCCCTGCCCTTCTTCCTTTTCCGCCAGGCTTACCATCCAAACAATTCCAGTCCAGTTTG
CTATGAGGTCCTGGGAAATGACACAGCAAAATGGCGGATGGTGTTGCGGATCCTGCCTCACACCTTTGGC
TTCATCGTGCCGCTGTTTGTCATGCTGTTCTGCTATGGATTCACCCTGCGTACACTGTTTAAGGCCCACA
TGGGGCAGAAGCACCGAGCCATGAGGGTCATCTTTGCTGTCGTCCTCATCTTCCTGCTTTGCTGGCTGCC
CTACAACCTGGTCCTGCTGGCAGACACCCTCATGAGGACCCAGGTGATCCAGGAGAGCTGTGAGCGCCGC
AACAACATCGGCCGGGCCCTGGATGCCACTGAGATTCTGGGATTTCTCCATAGCTGCCTCAACCCCATCA
TCTACGCCTTCATCGGCCAAAATTTTCGCCATGGATTCCTCAAGATCCTGGCTATGCATGGCCTGGTCAG
CAAGGAGTTCTTGGCACGTCATTGTGTTACCTCCTACACTTCTTCGTCTGTCAATGTCTCTTCCAACCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207019 protein sequence
Red=Cloning site Green=Tags(s)

MSNITDPQMWDFDDLNFTGMPPADEDYSPCRLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVG
RSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIV
HATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFG
FIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERR
NNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHCVTSYTSSSVNVSSNL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000634
ORF Size 1050 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000634.3
RefSeq Size 2502 bp
RefSeq ORF 1053 bp
Locus ID 3577
UniProt ID P25024
Cytogenetics 2q35
Domains 7tm_1
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection
MW 39.8 kDa
Summary The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CXCR1 (NM_000634) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207019L1 Lenti ORF clone of Human chemokine (C-X-C motif) receptor 1 (CXCR1), Myc-DDK-tagged 10 ug
$757.00
RC207019L2 Lenti ORF clone of Human chemokine (C-X-C motif) receptor 1 (CXCR1), mGFP tagged 10 ug
$757.00
RC207019L3 Lenti ORF clone of Human chemokine (C-X-C motif) receptor 1 (CXCR1), Myc-DDK-tagged 10 ug
$757.00
RC207019L4 Lenti ORF clone of Human chemokine (C-X-C motif) receptor 1 (CXCR1), mGFP tagged 10 ug
$757.00
RG207019 CXCR1 (tGFP-tagged) - Human chemokine (C-X-C motif) receptor 1 (CXCR1) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC119771 CXCR1 (untagged)-Human chemokine (C-X-C motif) receptor 1 (CXCR1) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.