TMEM111 (EMC3) (NM_018447) Human Tagged ORF Clone

SKU
RC206832
EMC3 (Myc-DDK-tagged)-Human transmembrane protein 111 (TMEM111)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMEM111
Synonyms POB; TMEM111
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206832 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGGCCAGAACTGTTGCTCGACTCCAACATCCGCCTCTGGGTGGTCTTACCCATCGTTATCATCA
CTTTCTTCGTAGGCATGATCCGCCACTACGTGTCCATCCTGCTGCAGAGCGACAAGAAGCTCACCCAGGA
ACAAGTATCTGACAGTCAAGTCCTAATTCGAAGCAGAGTCCTCAGGGAAAATGGAAAATACATTCCCAAA
CAGTCTTTCTTGACACGAAAATATTATTTCAACAACCCAGAGGATGGATTTTTCAAAAAAACTAAACGGA
AGGTAGTGCCACCTTCTCCTATGACTGATCCTACTATGTTGACAGACATGATGAAAGGGAATGTAACAAA
TGTCCTCCCTATGATTCTTATTGGTGGATGGATCAACATGACATTCTCAGGCTTTGTCACAACCAAGGTC
CCATTTCCACTGACCCTCCGTTTTAAGCCTATGTTACAGCAAGGAATCGAGCTACTCACATTAGATGCAT
CCTGGGTGAGTTCTGCATCCTGGTACTTCCTCAATGTATTTGGGCTTCGGAGCATTTACTCTCTGATTCT
GGGCCAAGATAATGCCGCTGACCAATCACGAATGATGCAGGAGCAGATGACGGGAGCAGCCATGGCCATG
CCCGCAGACACAAACAAAGCTTTCAAGACAGAGTGGGAAGCTTTGGAGCTGACGGATCACCAGTGGGCAC
TAGATGATGTCGAAGAAGAGCTCATGGCCAAAGACCTCCACTTCGAAGGCATGTTCAAAAAGGAATTACA
GACCTCTATTTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206832 protein sequence
Red=Cloning site Green=Tags(s)

MAGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIPK
QSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKV
PFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAM
PADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018447
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018447.3
RefSeq Size 1107 bp
RefSeq ORF 786 bp
Locus ID 55831
UniProt ID Q9P0I2
Cytogenetics 3p25.3
Protein Families Transmembrane
MW 30 kDa
Summary Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins (PubMed:30415835, PubMed:29809151, PubMed:29242231, PubMed:32459176, PubMed:32439656). Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues (PubMed:30415835, PubMed:29809151, PubMed:29242231). Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices (PubMed:30415835, PubMed:29809151). It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes (PubMed:29809151, PubMed:29242231). By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors (PubMed:30415835). By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:TMEM111 (EMC3) (NM_018447) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206832L3 Lenti ORF clone of Human transmembrane protein 111 (TMEM111), Myc-DDK-tagged 10 ug
$600.00
RC206832L4 Lenti ORF clone of Human transmembrane protein 111 (TMEM111), mGFP tagged 10 ug
$600.00
RG206832 EMC3 (tGFP-tagged) - Human transmembrane protein 111 (TMEM111) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC113519 EMC3 (untagged)-Human transmembrane protein 111 (TMEM111) 10 ug
$300.00
SC324507 EMC3 (untagged)-Human transmembrane protein 111 (TMEM111) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.