GABARAPL1 (NM_031412) Human Tagged ORF Clone

SKU
RC206762
GABARAPL1 (Myc-DDK-tagged)-Human GABA(A) receptor-associated protein like 1 (GABARAPL1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GABARAPL1
Synonyms APG8-LIKE; APG8L; ATG8; ATG8B; ATG8L; GEC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206762 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTTCCAGTACAAGGAGGACCATCCCTTTGAGTATCGGAAAAAGGAAGGAGAAAAGATCCGGAAGA
AATATCCGGACAGGGTCCCCGTGATTGTAGAGAAGGCTCCAAAAGCCAGGGTGCCTGATCTGGACAAGAG
GAAGTACCTAGTGCCCTCTGACCTTACTGTTGGCCAGTTCTACTTCTTAATCCGGAAGAGAATCCACCTG
AGACCTGAGGACGCCTTATTCTTCTTTGTCAACAACACCATCCCTCCCACCAGTGCTACCATGGGCCAAC
TGTATGAGGACAATCATGAGGAAGACTATTTTCTGTATGTGGCCTACAGTGATGAGAGTGTCTATGGGAA
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206762 protein sequence
Red=Cloning site Green=Tags(s)

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHL
RPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_031412
ORF Size 351 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031412.4
RefSeq Size 1885 bp
RefSeq ORF 354 bp
Locus ID 23710
UniProt ID Q9H0R8
Cytogenetics 12p13.2
Domains MAP1_LC3
Protein Pathways Regulation of autophagy
MW 14 kDa
Summary Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:GABARAPL1 (NM_031412) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206762L1 Lenti ORF clone of Human GABA(A) receptor-associated protein like 1 (GABARAPL1), Myc-DDK-tagged 10 ug
$450.00
RC206762L2 Lenti ORF clone of Human GABA(A) receptor-associated protein like 1 (GABARAPL1), mGFP tagged 10 ug
$450.00
RC206762L3 Lenti ORF clone of Human GABA(A) receptor-associated protein like 1 (GABARAPL1), Myc-DDK-tagged 10 ug
$450.00
RC206762L4 Lenti ORF clone of Human GABA(A) receptor-associated protein like 1 (GABARAPL1), mGFP tagged 10 ug
$450.00
RG206762 GABARAPL1 (tGFP-tagged) - Human GABA(A) receptor-associated protein like 1 (GABARAPL1) 10 ug
$489.00
SC107225 GABARAPL1 (untagged)-Human GABA(A) receptor-associated protein like 1 (GABARAPL1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.