PHLDA3 (NM_012396) Human Tagged ORF Clone

SKU
RC206751
PHLDA3 (Myc-DDK-tagged)-Human pleckstrin homology-like domain, family A, member 3 (PHLDA3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Target Symbol PHLDA3
Synonyms TIH1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206751 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGCGGCGGCGACGGCTACCGTGCTCAAGGAGGGCGTGCTGGAGAAGCGCAGCGGCGGGCTGCTGC
AGCTGTGGAAGCGGAAGCGCTGCGTCCTCACCGAACGCGGGCTGCAGCTCTTCGAGGCCAAGGGCACGGG
CGGCCGGCCCAAGGAGCTCAGCTTCGCCCGCATCAAGGCCGTGGAGTGCGTGGAGAGCACCGGGCGCCAC
ATCTACTTCACGCTGGTGACCGAAGGGGGCGGCGAGATCGACTTCCGCTGCCCCCTGGAAGATCCCGGCT
GGAACGCCCAGATCACCCTAGGCCTGGTCAAGTTCAAGAACCAGCAGGCCATCCAGACAGTGCGGGCCCG
GCAGAGCCTCGGGACCGGGACCCTCGTGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206751 protein sequence
Red=Cloning site Green=Tags(s)

MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRH
IYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012396
ORF Size 381 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012396.5
RefSeq Size 1516 bp
RefSeq ORF 384 bp
Locus ID 23612
UniProt ID Q9Y5J5
Cytogenetics 1q32.1
Domains PH
MW 13.9 kDa
Summary p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PHLDA3 (NM_012396) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206751L1 Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 3 (PHLDA3), Myc-DDK-tagged 10 ug
$450.00
RC206751L2 Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 3 (PHLDA3), mGFP tagged 10 ug
$450.00
RC206751L3 Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 3 (PHLDA3), Myc-DDK-tagged 10 ug
$450.00
RC206751L4 Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 3 (PHLDA3), mGFP tagged 10 ug
$450.00
RG206751 PHLDA3 (tGFP-tagged) - Human pleckstrin homology-like domain, family A, member 3 (PHLDA3) 10 ug
$489.00
SC115414 PHLDA3 (untagged)-Human pleckstrin homology-like domain, family A, member 3 (PHLDA3) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.