Granzyme H (GZMH) (NM_033423) Human Tagged ORF Clone

SKU
RC206685
GZMH (Myc-DDK-tagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Granzyme H
Synonyms CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206685 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCCATTCCTCCTCCTGTTGGCCTTTCTTCTGACCCCTGGGGCTGGGACAGAGGAGATCATCGGGG
GCCATGAGGCCAAGCCCCACTCCCGCCCCTACATGGCCTTTGTTCAGTTTCTGCAAGAGAAGAGTCGGAA
GAGGTGTGGCGGCATCCTAGTGAGAAAGGACTTTGTGCTGACAGCTGCTCACTGCCAGGGAAGCTCCATA
AATGTCACCTTGGGGGCCCACAATATCAAGGAACAGGAGCGGACCCAGCAGTTTATCCCTGTGAAAAGAC
CCATCCCCCATCCAGCCTATAATCCTAAGAACTTCTCCAACGACATCATGCTACTGCAGCTGGAGAGAAA
GGCCAAGTGGACCACAGCTGTGCGGCCTCTCAGGCTACCTAGCAGCAAGGCCCAGGTGAAGCCAGGGCAG
CTGTGCAGTGTGGCTGGCTGGGGTTATGTCTCAATGAGCACTTTAGCAACCACACTGCAGGAAGTGTTGC
TGACAGTGCAGAAGGACTGCCAGTGTGAACGTCTCTTCCATGGCAATTACAGCAGAGCCACTGAGATTTG
TGTGGGGGATCCAAAGAAGACACAGACCGGTTTCAAGGGGGACTCCGGGGGGCCCCTCGTGTGTAAGGAC
GTAGCCCAAGGTATTCTCTCCTATGGAAACAAAAAAGGGACACCTCCAGGAGTCTACATCAAGGTCTCAC
ACTTCCTGCCCTGGATAAAGAGAACAATGAAGCGCCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206685 protein sequence
Red=Cloning site Green=Tags(s)

MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSI
NVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQ
LCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKD
VAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033423
ORF Size 738 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033423.5
RefSeq Size 987 bp
RefSeq ORF 741 bp
Locus ID 2999
UniProt ID P20718
Cytogenetics 14q12
Protein Families Druggable Genome, Protease
MW 27.3 kDa
Summary This gene encodes a member of the peptidase S1 family of serine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a chymotrypsin-like protease. This protein is reported to be constitutively expressed in the NK (natural killer) cells of the immune system and may play a role in the cytotoxic arm of the innate immune response by inducing target cell death and by directly cleaving substrates in pathogen-infected cells. This gene is present in a gene cluster with another member of the granzyme subfamily on chromosome 14. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:Granzyme H (GZMH) (NM_033423) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206685L3 Lenti ORF clone of Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), Myc-DDK-tagged 10 ug
$600.00
RC206685L4 Lenti ORF clone of Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), mGFP tagged 10 ug
$600.00
RG206685 GZMH (tGFP-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC125566 GZMH (untagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.