Cytoglobin (CYGB) (NM_134268) Human Tagged ORF Clone

SKU
RC206642
CYGB (Myc-DDK-tagged)-Human cytoglobin (CYGB)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cytoglobin
Synonyms HGB; STAP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206642 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAAAGTGCCAGGCGAGATGGAGATCGAGCGCAGGGAGCGGAGCGAGGAGCTGTCCGAGGCGGAGA
GGAAGGCGGTGCAGGCTATGTGGGCCCGGCTCTATGCCAGCTGCGAGGACGTGGGGGTGGCCATCCTGGT
GAGGTTCTTTGTGAACTTCCCCTCGGCCAAGCAGTACTTCAGCCAGTTCAAGCACATGGAGGATCCCCTG
GAGATGGAGCGGAGCCCCCAGCTGCGGAAGCACGCCTGCCGAGTCATGGGGGCCCTCAACACTGTCGTGG
AGAACCTGCATGACCCCGACAAGGTGTCCTCTGTGCTCGCCCTTGTGGGGAAAGCCCACGCCCTCAAGCA
CAAGGTGGAACCGGTGTACTTCAAGATCCTCTCTGGGGTCATTCTGGAGGTGGTCGCCGAGGAATTTGCC
AGTGACTTCCCACCTGAGACGCAGAGAGCCTGGGCCAAGCTGCGTGGCCTCATCTACAGCCACGTGACCG
CTGCCTACAAGGAAGTGGGCTGGGTGCAGCAGGTCCCCAACGCCACCACCCCACCGGCCACACTGCCCTC
TTCGGGGCCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206642 protein sequence
Red=Cloning site Green=Tags(s)

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPL
EMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFA
SDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_134268
ORF Size 570 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_134268.5
RefSeq Size 2166 bp
RefSeq ORF 573 bp
Locus ID 114757
UniProt ID Q8WWM9
Cytogenetics 17q25.1
Domains globin
MW 21.4 kDa
Summary This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protection during oxidative stress. This gene is located on chromosome 17 in the same region as a retinal gene which is mutated in progressive rod-cone degeneration, but in the opposite orientation. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:Cytoglobin (CYGB) (NM_134268) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206642L3 Lenti ORF clone of Human cytoglobin (CYGB), Myc-DDK-tagged 10 ug
$600.00
RC206642L4 Lenti ORF clone of Human cytoglobin (CYGB), mGFP tagged 10 ug
$600.00
RG206642 CYGB (tGFP-tagged) - Human cytoglobin (CYGB) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC321813 CYGB (untagged)-Human cytoglobin (CYGB) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.