Calcineurin B (PPP3R1) (NM_000945) Human Tagged ORF Clone

SKU
RC206585
PPP3R1 (Myc-DDK-tagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Calcineurin B
Synonyms CALNB1; CNB; CNB1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206585 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAATGAGGCAAGTTATCCTTTGGAAATGTGCTCACACTTTGATGCGGATGAAATTAAAAGGCTAG
GAAAGAGATTTAAGAAGCTTGATTTGGACAATTCTGGTTCTTTGAGTGTGGAAGAGTTCATGTCTCTGCC
TGAGTTACAACAGAATCCTTTAGTACAGCGAGTAATAGATATATTCGACACAGATGGGAATGGAGAAGTA
GACTTTAAAGAATTCATTGAGGGCGTCTCTCAGTTCAGTGTCAAAGGAGATAAGGAGCAGAAATTGAGGT
TTGCTTTCCGTATCTATGACATGGATAAAGATGGCTATATTTCCAATGGGGAACTCTTCCAGGTATTGAA
GATGATGGTGGGGAACAATCTGAAAGATACACAGTTACAGCAAATTGTAGACAAAACCATAATAAATGCA
GATAAGGATGGAGATGGAAGAATATCCTTTGAAGAATTCTGTGCTGTTGTAGGTGGCCTAGATATCCACA
AAAAGATGGTGGTAGATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206585 protein sequence
Red=Cloning site Green=Tags(s)

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINA
DKDGDGRISFEEFCAVVGGLDIHKKMVVDV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000945
ORF Size 510 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000945.4
RefSeq Size 3111 bp
RefSeq ORF 513 bp
Locus ID 5534
UniProt ID P63098
Cytogenetics 2p14
Domains EFh
Protein Families Druggable Genome, Phosphatase
Protein Pathways Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway
MW 19.3 kDa
Summary Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Calcineurin B (PPP3R1) (NM_000945) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206585L3 Lenti ORF clone of Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), Myc-DDK-tagged 10 ug
$600.00
RC206585L4 Lenti ORF clone of Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), mGFP tagged 10 ug
$600.00
RG206585 PPP3R1 (tGFP-tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC127998 PPP3R1 (untagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1) 10 ug
$300.00
SC322580 PPP3R1 (untagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.