Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Tagged ORF Clone

SKU
RC206523
CCL19 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 19 (CCL19)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Macrophage Inflammatory Protein 3 beta
Synonyms CKb11; ELC; MIP-3b; MIP3B; SCYA19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206523 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTGCTACTGGCCCTCAGCCTGCTGGTTCTCTGGACTTCCCCAGCCCCAACTCTGAGTGGCACCA
ATGATGCTGAAGACTGCTGCCTGTCTGTGACCCAGAAACCCATCCCTGGGTACATCGTGAGGAACTTCCA
CTACCTTCTCATCAAGGATGGCTGCAGGGTGCCTGCTGTAGTGTTCACCACACTGAGGGGCCGCCAGCTC
TGTGCACCCCCAGACCAGCCCTGGGTAGAACGCATCATCCAGAGACTGCAGAGGACCTCAGCCAAGATGA
AGCGCCGCAGCAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206523 protein sequence
Red=Cloning site Green=Tags(s)

MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQL
CAPPDQPWVERIIQRLQRTSAKMKRRSS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006274
ORF Size 294 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006274.3
RefSeq Size 684 bp
RefSeq ORF 297 bp
Locus ID 6363
UniProt ID Q99731
Cytogenetics 9p13.3
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
MW 11 kDa
Summary This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206523L1 Lenti ORF clone of Human chemokine (C-C motif) ligand 19 (CCL19), Myc-DDK-tagged 10 ug
$450.00
RC206523L2 Lenti ORF clone of Human chemokine (C-C motif) ligand 19 (CCL19), mGFP tagged 10 ug
$450.00
RC206523L3 Lenti ORF clone of Human chemokine (C-C motif) ligand 19 (CCL19), Myc-DDK-tagged 10 ug
$450.00
RC206523L4 Lenti ORF clone of Human chemokine (C-C motif) ligand 19 (CCL19), mGFP tagged 10 ug
$450.00
RG206523 CCL19 (tGFP-tagged) - Human chemokine (C-C motif) ligand 19 (CCL19) 10 ug
$489.00
SC122744 CCL19 (untagged)-Human chemokine (C-C motif) ligand 19 (CCL19) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.