Bonzo (CXCR6) (NM_006564) Human Tagged ORF Clone

SKU
RC206517
CXCR6 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) receptor 6 (CXCR6)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $457.00 MSRP $457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Bonzo
Synonyms BONZO; CD186; CDw186; STRL33; TYMSTR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206517 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGCATGATTACCATGAAGACTATGGGTTCAGCAGTTTCAATGACAGCAGCCAGGAGGAGCATC
AAGACTTCCTGCAGTTCAGCAAGGTCTTTCTGCCCTGCATGTACCTGGTGGTGTTTGTCTGTGGTCTGGT
GGGGAACTCTCTGGTGCTGGTCATATCCATCTTCTACCATAAGTTGCAGAGCCTGACGGATGTGTTCCTG
GTGAACCTACCCCTGGCTGACCTGGTGTTTGTCTGCACTCTGCCCTTCTGGGCCTATGCAGGCATCCATG
AATGGGTGTTTGGCCAGGTCATGTGCAAGAGCCTACTGGGCATCTACACTATTAACTTCTACACGTCCAT
GCTCATCCTCACCTGCATCACTGTGGATCGTTTCATTGTAGTGGTTAAGGCCACCAAGGCCTACAACCAG
CAAGCCAAGAGGATGACCTGGGGCAAGGTCACCAGCTTGCTCATCTGGGTGATATCCCTGCTGGTTTCCT
TGCCCCAAATTATCTATGGCAATGTCTTTAATCTCGACAAGCTCATATGTGGTTACCATGACGAGGCAAT
TTCCACTGTGGTTCTTGCCACCCAGATGACACTGGGGTTCTTCTTGCCACTGCTCACCATGATTGTCTGC
TATTCAGTCATAATCAAAACACTGCTTCATGCTGGAGGCTTCCAGAAGCACAGATCTCTAAAGATCATCT
TCCTGGTGATGGCTGTGTTCCTGCTGACCCAGATGCCCTTCAACCTCATGAAGTTCATCCGCAGCACACA
CTGGGAATACTATGCCATGACCAGCTTTCACTACACCATCATGGTGACAGAGGCCATCGCATACCTGAGG
GCCTGCCTTAACCCTGTGCTCTATGCCTTTGTCAGCCTGAAGTTTCGAAAGAACTTCTGGAAACTTGTGA
AGGACATTGGTTGCCTCCCTTACCTTGGGGTCTCACATCAATGGAAATCTTCTGAGGACAATTCCAAGAC
TTTTTCTGCCTCCCACAATGTGGAGGCCACCAGCATGTTCCAGTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206517 protein sequence
Red=Cloning site Green=Tags(s)

MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFL
VNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQ
QAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVC
YSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLR
ACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006564
ORF Size 1026 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006564.2
RefSeq Size 1953 bp
RefSeq ORF 1029 bp
Locus ID 10663
UniProt ID O00574
Cytogenetics 3p21.31
Domains 7tm_1
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
MW 39.3 kDa
Summary The protein encoded by this gene is a G protein-coupled receptor with seven transmembrane domains that belongs to the CXC chemokine receptor family. This family also includes CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, and CXCR7. This gene, which maps to the chemokine receptor gene cluster, is expressed in several T lymphocyte subsets and bone marrow stromal cells. The encoded protein and its exclusive ligand, chemokine ligand 16 (CCL16), are part of a signalling pathway that regulates T lymphocyte migration to various peripheral tissues (the liver, spleen red pulp, intestine, lungs, and skin) and promotes cell-cell interaction with dendritic cells and fibroblastic reticular cells. CXCR6/CCL16 also controls the localization of resident memory T lymphocytes to different compartments of the lung and maintains airway resident memory T lymphocytes, which are an important first line of defense against respiratory pathogens. The encoded protein serves as an entry coreceptor used by HIV-1 and SIV to enter target cells, in conjunction with CD4. [provided by RefSeq, Aug 2020]
Write Your Own Review
You're reviewing:Bonzo (CXCR6) (NM_006564) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206517L1 Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), Myc-DDK-tagged 10 ug
$757.00
RC206517L2 Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), mGFP tagged 10 ug
$757.00
RC206517L3 Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), Myc-DDK-tagged 10 ug
$757.00
RC206517L4 Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), mGFP tagged 10 ug
$757.00
RG206517 CXCR6 (tGFP-tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC321785 CXCR6 (untagged)-Human chemokine (C-X-C motif) receptor 6 (CXCR6) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.