alpha Defensin 1 (DEFA1B) (NM_001042500) Human Tagged ORF Clone

SKU
RC206426
DEFA1B (Myc-DDK-tagged)-Human defensin, alpha 1B (DEFA1B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol alpha Defensin 1
Synonyms HNP-1; HP-1; HP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206426 representing NM_001042500
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGACCCTCGCCATCCTTGCTGCCATTCTCCTGGTGGCCCTGCAGGCCCAGGCTGAGCCACTCCAGG
CAAGAGCTGATGAGGTTGCTGCAGCCCCGGAGCAGATTGCAGCGGACATCCCAGAAGTGGTTGTTTCCCT
TGCATGGGACGAAAGCTTGGCTCCAAAGCATCCAGGCTCAAGGAAAAACATGGCCTGCTATTGCAGAATA
CCAGCGTGCATTGCAGGAGAACGTCGCTATGGAACCTGCATCTACCAGGGAAGACTCTGGGCATTCTGCT
GC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206426 representing NM_001042500
Red=Cloning site Green=Tags(s)

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRI
PACIAGERRYGTCIYQGRLWAFCC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001042500
ORF Size 282 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001042500.1, NP_001035965.1
RefSeq Size 498 bp
RefSeq ORF 285 bp
Locus ID 728358
UniProt ID P59665
Cytogenetics 8p23.1
Protein Families Druggable Genome
MW 10 kDa
Summary Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:alpha Defensin 1 (DEFA1B) (NM_001042500) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206426L3 Lenti-ORF clone of DEFA1B (Myc-DDK-tagged)-Human defensin, alpha 1B (DEFA1B) 10 ug
$450.00
RC206426L4 Lenti-ORF clone of DEFA1B (mGFP-tagged)-Human defensin, alpha 1B (DEFA1B) 10 ug
$450.00
RG206426 DEFA1B (tGFP-tagged) - Human defensin, alpha 1B (DEFA1B) 10 ug
$350.00
SC321787 DEFA1B (untagged)-Human defensin, alpha 1B (DEFA1B) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.