RAB33B (NM_031296) Human Tagged ORF Clone

SKU
RC206242
RAB33B (Myc-DDK-tagged)-Human RAB33B, member RAS oncogene family (RAB33B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB33B
Synonyms SMC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206242 representing NM_031296
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAGGAGATGGAGTCGTCGCTCGAGGCAAGCTTTTCGTCCAGCGGGGCAGTGTCAGGGGCCTCAG
GGTTTTTGCCTCCTGCCCGCTCCCGCATCTTCAAGATAATCGTGATCGGCGACTCCAATGTGGGCAAGAC
ATGCCTGACCTACCGCTTCTGCGCTGGCCGCTTCCCCGACCGCACCGAGGCCACGATAGGGGTGGATTTC
CGAGAACGAGCGGTGGAGATTGATGGGGAGCGCATCAAGATCCAGCTATGGGACACAGCAGGACAAGAAC
GATTCAGAAAGAGCATGGTTCAGCACTACTACAGAAATGTACATGCTGTTGTCTTCGTGTATGATATGAC
CAACATGGCTAGTTTTCATAGCCTACCATCTTGGATAGAAGAATGCAAACAACATTTGCTAGCCAATGAT
ATACCACGGATTCTTGTTGGAAATAAATGTGACTTGAGAAGTGCCATACAGGTACCCACAGACTTGGCAC
AAAAATTTGCTGACACACACAGTATGCCTTTGTTTGAAACGTCTGCTAAAAACCCCAATGATAATGACCA
TGTGGAAGCTATATTTATGACCTTGGCTCATAAGCTTAAGAGCCACAAACCATTAATGCTTAGTCAGCCC
CCTGATAATGGAATTATCCTGAAGCCTGAACCAAAGCCTGCAATGACGTGCTGGTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206242 representing NM_031296
Red=Cloning site Green=Tags(s)

MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDF
RERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLAND
IPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQP
PDNGIILKPEPKPAMTCWC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_031296
ORF Size 687 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031296.3
RefSeq Size 3876 bp
RefSeq ORF 690 bp
Locus ID 83452
UniProt ID Q9H082
Cytogenetics 4q31.1
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
MW 25.5 kDa
Summary This gene encodes a small GTP-binding protein of the Rab GTPase family, whose members function in vesicle transport during protein secretion and endocytosis. Rab GTPases are active, membrane-associated proteins that recruit effector proteins in the GTP-bound state and inactive cytosolic proteins when in a GDP-bound state. The protein encoded by this gene is ubiquitously expressed and has been implicated in Golgi to endoplasmic reticulum cycling of Golgi enzymes. In addition, this protein regulates Golgi homeostasis and coordinates intra-Golgi retrograde trafficking. Allelic variants in this gene have been associated with Dyggve-Melchior-Clausen syndrome and Smith-McCort dysplasia 2, which are autosomal recessive spondyloepimetaphyseal dysplasias characterized by skeletal abnormalities. [provided by RefSeq, Sep 2016]
Write Your Own Review
You're reviewing:RAB33B (NM_031296) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206242L1 Lenti ORF clone of Human RAB33B, member RAS oncogene family (RAB33B), Myc-DDK-tagged 10 ug
$750.00
RC206242L2 Lenti ORF clone of Human RAB33B, member RAS oncogene family (RAB33B), mGFP tagged 10 ug
$750.00
RC206242L3 Lenti ORF clone of Human RAB33B, member RAS oncogene family (RAB33B), Myc-DDK-tagged 10 ug
$750.00
RC206242L4 Lenti ORF clone of Human RAB33B, member RAS oncogene family (RAB33B), mGFP tagged 10 ug
$750.00
RG206242 RAB33B (tGFP-tagged) - Human RAB33B, member RAS oncogene family (RAB33B) 10 ug
$650.00
SC107713 RAB33B (untagged)-Human RAB33B, member RAS oncogene family (RAB33B) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.