ATF1 (NM_005171) Human Tagged ORF Clone

SKU
RC205923
ATF1 (Myc-DDK-tagged)-Human activating transcription factor 1 (ATF1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ATF1
Synonyms EWS-ATF1; FUS/ATF-1; TREB36
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205923 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGATTCCCACAAGAGTACCACGTCAGAGACAGCACCTCAACCTGGTTCAGCAGTTCAGGGAGCTC
ACATTTCTCATATTGCTCAACAGGTATCATCTTTATCAGAAAGTGAGGAGTCCCAGGACTCATCCGACAG
CATAGGCTCCTCACAGAAAGCCCACGGGATCCTAGCACGGCGCCCATCTTACAGAAAAATTTTGAAAGAC
TTATCTTCTGAAGATACACGGGGCAGAAAAGGAGACGGAGAAAATTCTGGAGTTTCTGCTGCTGTCACTT
CTATGTCTGTTCCAACTCCCATCTATCAGACTAGCAGCGGACAGTATATTGCCATTGCCCCAAATGGAGC
CTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGC
AGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCA
GCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGC
TACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGAT
GACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGA
AGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGA
AGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205923 protein sequence
Red=Cloning site Green=Tags(s)

MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKD
LSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSG
STQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTD
DPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005171
ORF Size 813 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005171.5
RefSeq Size 2505 bp
RefSeq ORF 816 bp
Locus ID 466
UniProt ID P18846
Cytogenetics 12q13.12
Domains BRLZ, pKID
Protein Families Druggable Genome, Transcription Factors
MW 29.2 kDa
Summary This gene encodes an activating transcription factor, which belongs to the ATF subfamily and bZIP (basic-region leucine zipper) family. It influences cellular physiologic processes by regulating the expression of downstream target genes, which are related to growth, survival, and other cellular activities. This protein is phosphorylated at serine 63 in its kinase-inducible domain by serine/threonine kinases, cAMP-dependent protein kinase A, calmodulin-dependent protein kinase I/II, mitogen- and stress-activated protein kinase and cyclin-dependent kinase 3 (cdk-3). Its phosphorylation enhances its transactivation and transcriptional activities, and enhances cell transformation. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in angiomatoid fibrous histiocytoma and clear cell sarcoma. This gene has a pseudogene on chromosome 6. [provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:ATF1 (NM_005171) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205923L1 Lenti ORF clone of Human activating transcription factor 1 (ATF1), Myc-DDK-tagged 10 ug
$600.00
RC205923L2 Lenti ORF clone of Human activating transcription factor 1 (ATF1), mGFP tagged 10 ug
$600.00
RC205923L3 Lenti ORF clone of Human activating transcription factor 1 (ATF1), Myc-DDK-tagged 10 ug
$600.00
RC205923L4 Lenti ORF clone of Human activating transcription factor 1 (ATF1), mGFP tagged 10 ug
$600.00
RG205923 ATF1 (tGFP-tagged) - Human activating transcription factor 1 (ATF1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319835 ATF1 (untagged)-Human activating transcription factor 1 (ATF1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.