GNGT1 (NM_021955) Human Tagged ORF Clone

SKU
RC205899
GNGT1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GNGT1
Synonyms GNG1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205899 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGTAATCAATATTGAGGACCTGACAGAAAAGGACAAATTGAAGATGGAAGTTGACCAGCTCAAGA
AAGAAGTGACACTGGAAAGAATGCTAGTTTCCAAATGTTGTGAAGAAGTAAGAGATTACGTTGAAGAACG
ATCTGGCGAGGATCCACTGGTAAAGGGCATCCCAGAGGACAAAAATCCCTTCAAGGAGCTCAAAGGAGGC
TGTGTGATTTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205899 protein sequence
Red=Cloning site Green=Tags(s)

MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG
CVIS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021955
ORF Size 222 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021955.5
RefSeq Size 628 bp
RefSeq ORF 225 bp
Locus ID 2792
UniProt ID P63211
Cytogenetics 7q21.3
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway
MW 8.5 kDa
Summary This gene encodes the gamma subunit of transducin, a guanine nucleotide-binding protein (G protein) that is found in rod outer segments. Transducin, also known as GMPase, mediates the activation of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase by rhodopsin. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:GNGT1 (NM_021955) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205899L3 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), Myc-DDK-tagged 10 ug
$450.00
RC205899L4 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mGFP tagged 10 ug
$450.00
RG205899 GNGT1 (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1) 10 ug
$489.00
SC122919 GNGT1 (untagged)-Human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.