CSHL1 (NM_001318) Human Tagged ORF Clone

SKU
RC205897
CSHL1 (Myc-DDK-tagged)-Human chorionic somatomammotropin hormone-like 1 (CSHL1), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CSHL1
Synonyms CS-5; CSHP1; CSL; GHB4; hCS-L
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205897 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAAACGCAGCAGAAATCCAACTTAGAGCTGCTCCACATCTCCCTGCTGCTCATCGAGTCGCGGC
TGGAGCCCGTGCGGTTCCTCAGGAGTACCTTCACCAACAACCTGGTGTATGACACCTCGGACAGCGATGA
CTATCACCTCCTAAAGGACCTAGAGGAAGGCATCCAAATGCTGATGGGGAGGCTGGAAGACGGCAGCCAC
CTGACTGGGCAGACCCTCAAGCAGACCTACAGCAAGTTTGACACAAACTCGCACAACCATGACGCACTGC
TCAAGAACTACGGGCTGCTCCACTGCTTCAGGAAGGACATGGACAAGGTCGAGACATTCCTGCGCATGGT
GCAGTGCCGCTCTGTGGAGGGCAGCTGTGGCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205897 protein sequence
Red=Cloning site Green=Tags(s)

MEETQQKSNLELLHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSH
LTGQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001318
ORF Size 384 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001318.4
RefSeq Size 661 bp
RefSeq ORF 387 bp
Locus ID 1444
Cytogenetics 17q23.3
Domains hormone
Protein Families Secreted Protein
MW 14.9 kDa
Summary The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CSHL1 (NM_001318) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205897L3 Lenti ORF clone of Human chorionic somatomammotropin hormone-like 1 (CSHL1), transcript variant 3, Myc-DDK-tagged 10 ug
$450.00
RC205897L4 Lenti ORF clone of Human chorionic somatomammotropin hormone-like 1 (CSHL1), transcript variant 3, mGFP tagged 10 ug
$450.00
RG205897 CSHL1 (tGFP-tagged) - Human chorionic somatomammotropin hormone-like 1 (CSHL1), transcript variant 3 10 ug
$489.00
SC109123 CSHL1 (untagged)-Human chorionic somatomammotropin hormone-like 1 (CSHL1), transcript variant 3 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.