QRX (RAX2) (NM_032753) Human Tagged ORF Clone

SKU
RC205805
RAX2 (Myc-DDK-tagged)-Human retina and anterior neural fold homeobox 2 (RAX2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol QRX
Synonyms ARMD6; CORD11; QRX; RAXL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205805 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCTGAGCCCGGGCGAGGGGCCGGCAACCGAGGGTGGGGGTCTGGGGCCGGGCGAGGAGGCCCCCA
AGAAGAAGCACCGGAGGAACCGCACCACCTTCACCACCTACCAGCTGCACCAGCTGGAGCGGGCGTTCGA
GGCCTCTCACTACCCGGATGTGTACAGCCGTGAGGAGCTGGCAGCCAAGGTGCACCTACCTGAGGTGCGC
GTGCAGGTGTGGTTCCAGAACCGCCGGGCCAAGTGGCGCCGCCAGGAGCGGCTGGAGTCAGGCTCGGGTG
CCGTGGCAGCTCCGAGACTCCCCGAGGCCCCAGCGCTGCCGTTCGCCCGCCCCCCGGCCATGTCGCTGCC
CCTGGAGCCCTGGTTGGGCCCCGGACCGCCGGCCGTGCCAGGCCTCCCCCGCCTCCTGGGCCCGGGCCCG
GGGCTGCAAGCGTCCTTCGGGCCTCATGCCTTTGCTCCCACCTTCGCAGATGGCTTCGCCCTGGAGGAGG
CGTCCCTGCGGCTGCTGGCCAAGGAACATGCACAGGCTCTGGACAGGGCCTGGCCGCCAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205805 protein sequence
Red=Cloning site Green=Tags(s)

MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVR
VQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGP
GLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032753
ORF Size 552 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032753.4
RefSeq Size 2190 bp
RefSeq ORF 555 bp
Locus ID 84839
UniProt ID Q96IS3
Cytogenetics 19p13.3
Protein Families Transcription Factors
MW 20.1 kDa
Summary This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation of this gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneath the retinal pigment epithelium and within the Bruch's membrane. Defects in this gene can also cause cone-rod dystrophy type 11, a disease characterized by the initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed by the degeneration of rod photoreceptor cells, which progresses to night blindness and the loss of peripheral vision. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:QRX (RAX2) (NM_032753) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205805L3 Lenti ORF clone of Human retina and anterior neural fold homeobox 2 (RAX2), Myc-DDK-tagged 10 ug
$600.00
RC205805L4 Lenti ORF clone of Human retina and anterior neural fold homeobox 2 (RAX2), mGFP tagged 10 ug
$600.00
RG205805 RAX2 (tGFP-tagged) - Human retina and anterior neural fold homeobox 2 (RAX2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC123056 RAX2 (untagged)-Human retina and anterior neural fold homeobox 2 (RAX2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.