DLX3 (NM_005220) Human Tagged ORF Clone

SKU
RC205795
DLX3 (Myc-DDK-tagged)-Human distal-less homeobox 3 (DLX3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DLX3
Synonyms AI4; TDO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205795 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGGCTCCTTCGATCGCAAGCTCAGCAGCATCCTCACCGACATCTCCAGCTCCCTTAGCTGCCATG
CGGGCTCCAAGGACTCGCCTACCCTGCCCGAGTCTTCTGTCACTGACCTGGGCTACTACAGCGCTCCCCA
GCACGATTACTACTCGGGCCAGCCCTATGGCCAGACGGTGAACCCCTACACCTACCACCACCAATTCAAT
CTCAATGGGCTTGCAGGCACGGGCGCTTACTCGCCCAAGTCGGAATATACCTACGGAGCCTCCTACCGGC
AATACGGGGCGTATCGGGAGCAGCCGCTGCCAGCCCAGGACCCAGTGTCGGTGAAGGAGGAGCCGGAAGC
AGAGGTGCGCATGGTGAATGGGAAGCCCAAGAAGGTCCGAAAGCCGCGTACAATCTACTCCAGCTACCAG
CTGGCCGCCCTGCAGCGCCGCTTCCAGAAGGCCCAGTACCTGGCGCTGCCCGAGCGCGCCGAGCTGGCCG
CGCAGCTGGGCCTCACGCAGACACAGGTGAAAATCTGGTTCCAGAACCGCCGTTCCAAGTTCAAGAAACT
CTACAAGAACGGGGAGGTGCCGCTGGAGCACAGTCCCAATAACAGTGATTCCATGGCCTGCAACTCACCA
CCATCACCCGCCCTCTGGGACACCTCTTCCCACTCCACTCCGGCCCCTGCCCGCAGTCAGCTGCCCCCGC
CGCTCCCATACAGTGCCTCCCCCAGCTACCTGGACGACCCCACCAACTCCTGGTATCACGCACAGAACCT
GAGTGGACCCCACTTACAGCAGCAGCCGCCTCAGCCAGCCACCCTGCACCATGCCTCTCCCGGGCCCCCG
CCCAACCCTGGGGCTGTGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205795 protein sequence
Red=Cloning site Green=Tags(s)

MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFN
LNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQ
LAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSP
PSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPP
PNPGAVY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005220
ORF Size 861 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005220.1
RefSeq Size 2613 bp
RefSeq ORF 864 bp
Locus ID 1747
UniProt ID O60479
Cytogenetics 17q21.33
Domains homeobox
Protein Families Druggable Genome, Transcription Factors
MW 31.7 kDa
Summary Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DLX3 (NM_005220) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205795L1 Lenti ORF clone of Human distal-less homeobox 3 (DLX3), Myc-DDK-tagged 10 ug
$600.00
RC205795L2 Lenti ORF clone of Human distal-less homeobox 3 (DLX3), mGFP tagged 10 ug
$600.00
RC205795L3 Lenti ORF clone of Human distal-less homeobox 3 (DLX3), Myc-DDK-tagged 10 ug
$600.00
RC205795L4 Lenti ORF clone of Human distal-less homeobox 3 (DLX3), mGFP tagged 10 ug
$600.00
RG205795 DLX3 (tGFP-tagged) - Human distal-less homeobox 3 (DLX3) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116854 DLX3 (untagged)-Human distal-less homeobox 3 (DLX3) 10 ug
$300.00
SC323820 DLX3 (untagged)-Human distal-less homeobox 3 (DLX3) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.