MTX2 (NM_001006635) Human Tagged ORF Clone

SKU
RC205693
MTX2 (Myc-DDK-tagged)-Human metaxin 2 (MTX2), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MTX2
Synonyms MDPS; metaxin-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205693 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATATAGCTGCAGAACCTTGGCCTGAAAATGCTACATTATATCAGCAATTGAAAGGGGAGCAAATTT
TACTTTCTGACAATGCAGCTTCTCTTGCAGTGCAGGCCTTTTTGCAAATGTGTAACTTGCCTATCAAAGT
AGTTTGTAGGGCAAATGCAGAATATATGTCTCCATCTGGTAAAGTACCTTTTATTCATGTGGGAAATCAA
GTAGTATCAGAACTTGGTCCAATAGTCCAATTTGTTAAAGCCAAGGGCCATTCTCTTAGTGATGGGCTGG
AGGAAGTCCAAAAAGCAGAAATGAAAGCTTACATGGAATTAGTCAACAATATGCTGTTGACTGCAGAGCT
GTATCTTCAGTGGTGTGATGAAGCTACAGTAGGGGAGATCACTCATGCTAGGTATGGATCTCCTTACCCT
TGGCCTCTGAATCATATTTTGGCCTATCAAAAACAGTGGGAAGTCAAACGTAAGATGAAAGCTATTGGAT
GGGGAAAGAAGACTCTGGACCAGGTCTTAGAGGATGTAGACCAGTGCTGTCAAGCTCTCTCTCAAAGACT
GGGAACACAACCGTATTTCTTCAATAAGCAGCCTACTGAACTTGACGCACTGGTATTTGGCCATCTATAC
ACCATTCTTACCACACAATTGACAAATGATGAACTTTCTGAGAAGGTGAAAAACTATAGCAACCTCCTTG
CTTTCTGTAGGAGAATTGAACAGCACTATTTTGAAGATCGTGGTAAAGGCAGGCTGTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205693 protein sequence
Red=Cloning site Green=Tags(s)

MYIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSGKVPFIHVGNQ
VVSELGPIVQFVKAKGHSLSDGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYP
WPLNHILAYQKQWEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLY
TILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFEDRGKGRLS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001006635
ORF Size 759 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001006635.3
RefSeq Size 1603 bp
RefSeq ORF 762 bp
Locus ID 10651
UniProt ID O75431
Cytogenetics 2q31.1
MW 28.8 kDa
Summary The protein encoded by this gene is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane, and that it is involved in the import of proteins into the mitochondrion. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Jun 2009]
Write Your Own Review
You're reviewing:MTX2 (NM_001006635) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205693L3 Lenti ORF clone of Human metaxin 2 (MTX2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC205693L4 Lenti ORF clone of Human metaxin 2 (MTX2), transcript variant 2, mGFP tagged 10 ug
$600.00
RG205693 MTX2 (tGFP-tagged) - Human metaxin 2 (MTX2), transcript variant 2 10 ug
$500.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.