CBX1 (NM_006807) Human Tagged ORF Clone

SKU
RC205672
CBX1 (Myc-DDK-tagged)-Human chromobox homolog 1 (CBX1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CBX1
Synonyms CBX; HP1-BETA; HP1Hs-beta; HP1Hsbeta; M31; MOD1; p25beta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205672 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAAAAACAAAACAAGAAGAAAGTGGAGGAGGTGCTAGAAGAGGAGGAAGAGGAATATGTGGTGG
AAAAAGTTCTCGACCGTCGAGTGGTAAAGGGCAAAGTGGAGTACCTCCTAAAGTGGAAGGGATTCTCAGA
TGAGGACAACACATGGGAGCCAGAAGAGAACCTGGATTGCCCCGACCTCATTGCTGAGTTTCTGCAGTCA
CAGAAAACAGCACATGAGACAGATAAATCAGAGGGAGGCAAGCGCAAAGCTGATTCTGATTCTGAAGATA
AGGGAGAGGAGAGCAAACCAAAGAAGAAGAAAGAAGAGTCAGAAAAGCCACGAGGCTTTGCTCGAGGTTT
GGAGCCGGAGCGGATTATTGGAGCTACAGACTCCAGTGGAGAGCTCATGTTCCTGATGAAATGGAAAAAC
TCTGATGAGGCTGACCTGGTCCCTGCCAAGGAAGCCAATGTCAAGTGCCCACAGGTTGTCATATCCTTCT
ATGAGGAAAGGCTGACGTGGCATTCCTACCCCTCGGAGGATGATGACAAAAAAGATGACAAGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205672 protein sequence
Red=Cloning site Green=Tags(s)

MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQS
QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKN
SDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006807
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006807.5
RefSeq Size 2443 bp
RefSeq ORF 558 bp
Locus ID 10951
UniProt ID P83916
Cytogenetics 17q21.32
Domains CHROMO
MW 21.4 kDa
Summary This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CBX1 (NM_006807) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205672L1 Lenti ORF clone of Human chromobox homolog 1 (CBX1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205672L2 Lenti ORF clone of Human chromobox homolog 1 (CBX1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC205672L3 Lenti ORF clone of Human chromobox homolog 1 (CBX1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205672L4 Lenti ORF clone of Human chromobox homolog 1 (CBX1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG205672 CBX1 (tGFP-tagged) - Human chromobox homolog 1 (CBX1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC115861 CBX1 (untagged)-Human chromobox homolog 1 (CBX1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.