TIMM10 (NM_012456) Human Tagged ORF Clone

SKU
RC205668
TIMM10 (Myc-DDK-tagged)-Human translocase of inner mitochondrial membrane 10 homolog (yeast) (TIMM10), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TIMM10
Synonyms TIM10; TIM10A; TIMM10A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205668 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCTCTCAGGGCCCAACAGCTGGCTGCGGAGCTGGAGGTGGAGATGATGGCCGATATGTACAACA
GAATGACCAGTGCCTGCCACCGGAAGTGTGTGCCTCCTCACTACAAGGAAGCAGAGCTCTCCAAGGGCGA
GTCTGTGTGCCTGGACCGATGTGTCTCTAAGTACCTGGACATCCATGAGCGGATGGGCAAAAAGTTGACA
GAGTTGTCTATGCAGGATGAAGAGCTGATGAAGAGGGTGCAGCAGAGCTCTGGGCCTGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205668 protein sequence
Red=Cloning site Green=Tags(s)

MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLT
ELSMQDEELMKRVQQSSGPA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012456
ORF Size 270 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012456.3
RefSeq Size 684 bp
RefSeq ORF 273 bp
Locus ID 26519
UniProt ID P62072
Cytogenetics 11q12.1
Domains zf-Tim10_DDP
MW 10.3 kDa
Summary The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins. [provided by RefSeq, Nov 2011]
Write Your Own Review
You're reviewing:TIMM10 (NM_012456) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205668L3 Lenti ORF clone of Human translocase of inner mitochondrial membrane 10 homolog (yeast) (TIMM10), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC205668L4 Lenti ORF clone of Human translocase of inner mitochondrial membrane 10 homolog (yeast) (TIMM10), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
RG205668 TIMM10 (tGFP-tagged) - Human translocase of inner mitochondrial membrane 10 homolog (yeast) (TIMM10), nuclear gene encoding mitochondrial protein 10 ug
$489.00
SC115360 TIMM10 (untagged)-Human translocase of inner mitochondrial membrane 10 homolog (yeast) (TIMM10), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.