C1QA (NM_015991) Human Tagged ORF Clone

SKU
RC205653
C1QA (Myc-DDK-tagged)-Human complement component 1, q subcomponent, A chain (C1QA)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C1QA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205653 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGGTCCCCGGGGATGGCTGGTGCTCTGTGTGCTGGCCATATCGCTGGCCTCTATGGTGACCGAGG
ACTTGTGCCGAGCACCAGACGGGAAGAAAGGGGAGGCAGGAAGACCTGGCAGACGGGGGCGGCCAGGCCT
CAAGGGGGAGCAAGGGGAGCCGGGGGCCCCTGGCATCCGGACAGGCATCCAAGGCCTTAAAGGAGACCAG
GGGGAACCTGGGCCCTCTGGAAACCCCGGCAAGGTGGGCTACCCAGGGCCCAGCGGCCCCCTCGGGGCCC
GTGGCATCCCGGGAATTAAAGGCACCAAGGGCAGCCCAGGAAACATCAAGGACCAGCCGAGGCCAGCCTT
CTCCGCCATTCGGCGGAACCCCCCAATGGGGGGCAACGTGGTCATCTTCGACACGGTCATCACCAACCAG
GAAGAACCGTACCAGAACCACTCCGGCCGATTCGTCTGCACTGTACCCGGCTACTACTACTTCACCTTCC
AGGTGCTGTCCCAGTGGGAAATCTGCCTGTCCATCGTCTCCTCCTCAAGGGGCCAGGTCCGACGCTCCCT
GGGCTTCTGTGACACCACCAACAAGGGGCTCTTCCAGGTGGTGTCAGGGGGCATGGTGCTTCAGCTGCAG
CAGGGTGACCAGGTCTGGGTTGAAAAAGACCCCAAAAAGGGTCACATTTACCAGGGCTCTGAGGCCGACA
GCGTCTTCAGCGGCTTCCTCATCTTCCCATCTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205653 protein sequence
Red=Cloning site Green=Tags(s)

MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQ
GEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQ
EEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQ
QGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015991
ORF Size 735 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015991.1, NP_057075.1
RefSeq Size 1098 bp
RefSeq ORF 738 bp
Locus ID 712
UniProt ID P02745
Cytogenetics 1p36.12
Domains C1Q, Collagen
Protein Families Secreted Protein
Protein Pathways Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus
MW 26 kDa
Summary This gene encodes the A-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q deficiency is associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]
Write Your Own Review
You're reviewing:C1QA (NM_015991) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205653L1 Lenti ORF clone of Human complement component 1, q subcomponent, A chain (C1QA), Myc-DDK-tagged 10 ug
$600.00
RC205653L2 Lenti ORF clone of Human complement component 1, q subcomponent, A chain (C1QA), mGFP tagged 10 ug
$600.00
RC205653L3 Lenti ORF clone of Human complement component 1, q subcomponent, A chain (C1QA), Myc-DDK-tagged 10 ug
$600.00
RC205653L4 Lenti ORF clone of Human complement component 1, q subcomponent, A chain (C1QA), mGFP tagged 10 ug
$600.00
RG205653 C1QA (tGFP-tagged) - Human complement component 1, q subcomponent, A chain (C1QA) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319556 C1QA (untagged)-Human complement component 1, q subcomponent, A chain (C1QA) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.