BCAS2 (NM_005872) Human Tagged ORF Clone

SKU
RC205615
BCAS2 (Myc-DDK-tagged)-Human breast carcinoma amplified sequence 2 (BCAS2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BCAS2
Synonyms DAM1; Snt309; SPF27
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205615 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGCACAGGTTTGGTGGCTGGAGAGGTTGTGGTGGATGCGCTGCCGTATTTTGATCAAGGTTATG
AAGCCCCTGGTGTGCGGGAAGCGGCTGCAGCGCTGGTGGAGGAGGAAACTCGCAGATACCGACCTACTAA
GAACTACCTGAGCTACCTGACAGCCCCGGATTATTCTGCCTTTGAAACTGACATAATGAGAAATGAATTT
GAAAGACTGGCTGCTCGACAACCAATTGAATTGCTCAGTATGAAACGATATGAGCTTCCAGCCCCCTCCT
CTGGTCAAAAAAATGACATTACTGCATGGCAAGAATGTGTAAACAATTCTATGGCCCAGTTAGAGCATCA
AGCAGTTAGAATTGAGAATCTGGAACTAATGTCACAGCATGGATGTAATGCCTGGAAAGTATACAATGAA
AATCTAGTTCATATGATTGAACACGCACAGAAGGAACTTCAGAAGTTAAGAAAACATATTCAAGATTTAA
ACTGGCAGAGAAAGAACATGCAACTCACAGCTGGATCTAAATTGAGAGAAATGGAGTCAAATTGGGTATC
CCTGGTCAGTAAGAATTATGAGATTGAACGGACTATTGTTCAGCTAGAAAATGAAATCTATCAAATTAAG
CAGCAACATGGAGAGGCAAACAAAGAAAACATCCGGCAAGACTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205615 protein sequence
Red=Cloning site Green=Tags(s)

MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEF
ERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNE
NLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK
QQHGEANKENIRQDF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005872
ORF Size 675 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005872.3
RefSeq Size 1310 bp
RefSeq ORF 678 bp
Locus ID 10286
UniProt ID O75934
Cytogenetics 1p13.2
Protein Pathways Spliceosome
MW 26.1 kDa
Summary Required for pre-mRNA splicing as component of the activated spliceosome (PubMed:28502770, PubMed:28076346, PubMed:29360106, PubMed:29301961, PubMed:30705154). Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:BCAS2 (NM_005872) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205615L1 Lenti ORF clone of Human breast carcinoma amplified sequence 2 (BCAS2), Myc-DDK-tagged 10 ug
$600.00
RC205615L2 Lenti ORF clone of Human breast carcinoma amplified sequence 2 (BCAS2), mGFP tagged 10 ug
$600.00
RC205615L3 Lenti ORF clone of Human breast carcinoma amplified sequence 2 (BCAS2), Myc-DDK-tagged 10 ug
$600.00
RC205615L4 Lenti ORF clone of Human breast carcinoma amplified sequence 2 (BCAS2), mGFP tagged 10 ug
$600.00
RG205615 BCAS2 (tGFP-tagged) - Human breast carcinoma amplified sequence 2 (BCAS2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC112689 BCAS2 (untagged)-Human breast carcinoma amplified sequence 2 (BCAS2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.