RBJ (DNAJC27) (NM_016544) Human Tagged ORF Clone

SKU
RC205500
DNAJC27 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RBJ
Synonyms RabJS; RBJ
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205500 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCCAACATGCCGAAGCGGAAGGAGCCTGGCAGGTCTCTCCGCATCAAAGTCATCTCCATGGGCA
ACGCCGAAGTGGGGAAAAGCTGTATTATAAAGCGATACTGTGAGAAAAGATTCGTGTCTAAATACCTGGC
AACAATTGGAATTGACTATGGAGTCACAAAGGTACACGTCAGAGACAGAGAAATCAAAGTTAACATCTTT
GATATGGCTGGACATCCCTTCTTCTATGAGGTTCGAAATGAGTTTTACAAGGACACACAGGGTGTGATAC
TGGTCTATGATGTTGGGCAGAAAGACTCCTTTGACGCCCTTGATGCGTGGCTGGCAGAAATGAAGCAAGA
GCTTGGACCTCATGGAAACATGGAAAATATTATATTTGTAGTTTGTGCCAACAAGATTGATTGTACCAAA
CATCGCTGTGTAGATGAAAGTGAAGGACGTCTTTGGGCTGAAAGCAAAGGGTTCCTGTACTTTGAAACTT
CAGCACAAACTGGAGAAGGCATTAATGAGATGTTCCAGACCTTTTATATATCCATAGTTGATTTATGTGA
AAATGGCGGGAAACGCCCTACCACCAATAGCAGTGCTAGTTTCACCAAAGAACAAGCAGATGCCATTCGC
AGAATTCGAAATAGTAAAGACAGTTGGGACATGCTGGGAGTCAAACCTGGGGCCTCAAGGGATGAAGTCA
ATAAAGCGTATCGGAAACTTGCTGTGCTTCTTCACCCTGACAAATGTGTAGCACCTGGCAGTGAAGATGC
CTTCAAAGCAGTTGTGAATGCTCGGACAGCCCTCCTGAAAAACATCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205500 protein sequence
Red=Cloning site Green=Tags(s)

MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIF
DMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTK
HRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIR
RIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016544
ORF Size 819 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016544.1, NP_057628.1
RefSeq Size 5008 bp
RefSeq ORF 822 bp
Locus ID 51277
UniProt ID Q9NZQ0
Cytogenetics 2p23.3
Domains DnaJ, RAB, RAN, ras, RAS, RHO
MW 30.9 kDa
Summary GTPase which can activate the MEK/ERK pathway and induce cell transformation when overexpressed. May act as a nuclear scaffold for MAPK1, probably by association with MAPK1 nuclear export signal leading to enhanced ERK1/ERK2 signaling.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RBJ (DNAJC27) (NM_016544) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205500L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC205500L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), transcript variant 1, mGFP tagged 10 ug
$750.00
RC205500L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC205500L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), transcript variant 1, mGFP tagged 10 ug
$750.00
RG205500 DNAJC27 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), transcript variant 1 10 ug
$650.00
SC100369 DNAJC27 (untagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), transcript variant 1 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.