KHDRBS2 (NM_152688) Human Tagged ORF Clone

SKU
RC205428
KHDRBS2 (Myc-DDK-tagged)-Human KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KHDRBS2
Synonyms SLM-1; SLM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205428 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGAGGAGAAATATTTGCCTGAGCTGATGGCAGAGAAAGATAGCCTGGATCCATCTTTTGTGCATG
CGTCGCGCCTTTTGGCAGAAGAAATTGAAAAGTTTCAAGGTTCTGATGGAAAAAAGGAAGACGAAGAAAA
GAAGTATCTTGATGTCATCAGCAACAAAAACATAAAGCTCTCAGAAAGAGTACTGATTCCTGTCAAGCAG
TATCCAAAGTTCAATTTTGTGGGGAAATTGCTTGGACCAAGAGGAAACTCCTTGAAGAGGCTACAGGAAG
AAACAGGTGCTAAAATGTCTATCCTGGGCAAAGGATCAATGAGAGATAAAGCTAAGGAAGAAGAACTAAG
GAAGAGTGGGGAAGCCAAATATGCCCACTTGAGTGATGAGCTTCATGTATTAATTGAAGTGTTTGCTCCA
CCTGGGGAAGCTTATTCACGTATGAGTCATGCATTGGAAGAGATTAAAAAATTCCTGGTTCCTGACTACA
ATGATGAAATTCGTCAGGAACAACTACGTGAATTATCTTACTTAAATGGCTCAGAGGACTCTGGTCGTGG
CAGAGGTATTAGAGGCAGAGGGATCAGAATAGCTCCCACAGCTCCTTCAAGGGGCCGTGGGGGTGCCATT
CCTCCTCCCCCACCACCTGGACGAGGTGTTCTCACCCCTCGGGGAAGCACTGTAACCCGTGGAGCGCTTC
CAGTGCCACCTGTAGCAAGAGGTGTCCCTACCCCTCGAGCCCGGGGGGCACCAACAGTGCCAGGATACAG
GGCACCTCCTCCTCCAGCCCATGAAGCTTATGAAGAATATGGTTATGATGATGGCTACGGGGGTGAATAT
GATGACCAGACCTATGAGACTTATGATAACAGCTACGCGACCCAAACACAAAGTGTGCCTGAATACTATG
ACTACGGTCATGGAGTAAGTGAGGATGCCTATGACAGCTACGCACCAGAAGAATGGGCCACAACCAGCTC
TAGCTTGAAGGCACCACCGCAAAGGTCAGCCAGAGGGGGATACAGGGAACACCCCTATGGTAGATAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205428 protein sequence
Red=Cloning site Green=Tags(s)

MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQ
YPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAP
PGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAI
PPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEY
DDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTSSSLKAPPQRSARGGYREHPYGRY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152688
ORF Size 1047 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152688.1, NP_689901.1
RefSeq Size 2336 bp
RefSeq ORF 1050 bp
Locus ID 202559
UniProt ID Q5VWX1
Cytogenetics 6q11.1
Domains KH
MW 38.9 kDa
Summary RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Binds both poly(A) and poly(U) homopolymers. Phosphorylation by PTK6 inhibits its RNA-binding ability (By similarity). Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. Can regulate alternative splicing of NRXN1 in the laminin G-like domain 6 containing the evolutionary conserved neurexin alternative spliced segment 4 (AS4) involved in neurexin selective targeting to postsynaptic partners. Regulates cell-type specific alternative splicing of NRXN1 at AS4 and acts synergystically with SAM68 in exon skipping. In contrast acts antagonistically with SAM68 in NRXN3 exon skipping at AS4. Its phosphorylation by FYN inhibits its ability to regulate splice site selection. May function as an adapter protein for Src kinases during mitosis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:KHDRBS2 (NM_152688) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205428L1 Lenti ORF clone of Human KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2), Myc-DDK-tagged 10 ug
$757.00
RC205428L2 Lenti ORF clone of Human KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2), mGFP tagged 10 ug
$757.00
RC205428L3 Lenti ORF clone of Human KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2), Myc-DDK-tagged 10 ug
$757.00
RC205428L4 Lenti ORF clone of Human KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2), mGFP tagged 10 ug
$757.00
RG205428 KHDRBS2 (tGFP-tagged) - Human KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC100752 KHDRBS2 (untagged)-Human KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.