VPS26 (VPS26A) (NM_004896) Human Tagged ORF Clone

SKU
RC205353
VPS26A (Myc-DDK-tagged)-Human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol VPS26
Synonyms HB58; Hbeta58; PEP8A; VPS26
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205353 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTTTCTTGGAGGCTTTTTTGGTCCAATTTGTGAGATCGATATTGTTCTTAATGATGGGGAAACCA
GGAAAATGGCAGAAATGAAAACTGAAGATGGCAAAGTAGAAAAACACTATCTCTTCTATGACGGAGAATC
CGTTTCAGGAAAGGTAAACCTAGCCTTTAAGCAACCTGGAAAGAGGCTAGAACACCAAGGAATTAGAATT
GAATTTGTAGGTCAAATTGAACTTTTCAATGACAAGAGTAATACTCATGAATTTGTAAACCTAGTGAAAG
AACTAGCCTTACCTGGAGAACTGACTCAGAGCAGAAGTTATGATTTTGAATTTATGCAAGTTGAAAAGCC
ATATGAATCTTACATCGGTGCCAATGTCCGCTTGAGGTATTTTCTTAAAGTGACAATAGTGAGAAGACTG
ACAGATTTGGTAAAAGAGTATGATCTTATTGTTCACCAGCTTGCCACCTATCCTGATGTTAACAACTCTA
TTAAGATGGAAGTGGGCATTGAAGATTGTCTACATATAGAATTTGAATATAATAAATCAAAGTATCATTT
AAAGGATGTGATTGTTGGAAAAATTTACTTCTTATTAGTAAGAATAAAAATACAACATATGGAGTTACAG
CTGATCAAAAAAGAGATCACAGGAATTGGACCCAGTACCACAACAGAAACAGAAACAATCGCCAAATATG
AAATAATGGATGGTGCACCAGTAAAAGGTGAATCAATTCCAATAAGGCTATTTTTAGCAGGATATGACCC
AACTCCAACAATGAGAGATGTGAACAAAAAATTTTCAGTAAGGTACTTTTTGAATTTAGTGCTTGTTGAT
GAGGAAGACCGGAGGTACTTCAAACAGCAGGAGATAATTTTATGGAGAAAAGCTCCTGAAAAACTGAGGA
AACAGAGAACAAACTTTCACCAGCGATTTGAATCTCCAGAATCACAGGCATCTGCCGAACAGCCTGAAAT
G


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205353 protein sequence
Red=Cloning site Green=Tags(s)

MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRI
EFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRL
TDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQ
LIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVD
EEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004896
ORF Size 981 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004896.5
RefSeq Size 2707 bp
RefSeq ORF 984 bp
Locus ID 9559
UniProt ID O75436
Cytogenetics 10q22.1
Domains Vps26
MW 38.2 kDa
Summary This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:VPS26 (VPS26A) (NM_004896) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205353L1 Lenti ORF clone of Human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205353L2 Lenti ORF clone of Human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1, mGFP tagged 10 ug
$600.00
RC205353L3 Lenti ORF clone of Human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205353L4 Lenti ORF clone of Human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1, mGFP tagged 10 ug
$600.00
RG205353 VPS26A (tGFP-tagged) - Human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117087 VPS26A (untagged)-Human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.