ID2 (NM_002166) Human Tagged ORF Clone
SKU
RC205324
ID2 (Myc-DDK-tagged)-Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | ID2 |
Synonyms | bHLHb26; GIG8; ID2A; ID2H |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC205324 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAAGCCTTCAGTCCCGTGAGGTCCGTTAGGAAAAACAGCCTGTCGGACCACAGCCTGGGCATCTCCC GGAGCAAAACCCCTGTGGACGACCCGATGAGCCTGCTATACAACATGAACGACTGCTACTCCAAGCTCAA GGAGCTGGTGCCCAGCATCCCCCAGAACAAGAAGGTGAGCAAGATGGAAATCCTGCAGCACGTCATCGAC TACATCTTGGACCTGCAGATCGCCCTGGACTCGCATCCCACTATTGTCAGCCTGCATCACCAGAGACCCG GGCAGAACCAGGCGTCCAGGACGCCGCTGACCACCCTCAACACGGATATCAGCATCCTGTCCTTGCAGGC TTCTGAATTCCCTTCTGAGTTAATGTCAAATGACAGCAAAGCACTGTGTGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205324 protein sequence
Red=Cloning site Green=Tags(s) MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVID YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002166 |
ORF Size | 402 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_002166.5 |
RefSeq Size | 1402 bp |
RefSeq ORF | 405 bp |
Locus ID | 3398 |
UniProt ID | Q02363 |
Cytogenetics | 2p25.1 |
Domains | HLH |
Protein Families | ES Cell Differentiation/IPS, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
MW | 14.9 kDa |
Summary | The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC205324L1 | Lenti ORF clone of Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), Myc-DDK-tagged | 10 ug |
$525.00
|
|
RC205324L2 | Lenti ORF clone of Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), mGFP tagged | 10 ug |
$525.00
|
|
RC205324L3 | Lenti ORF clone of Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), Myc-DDK-tagged | 10 ug |
$525.00
|
|
RC205324L4 | Lenti ORF clone of Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), mGFP tagged | 10 ug |
$525.00
|
|
RG205324 | ID2 (tGFP-tagged) - Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2) | 10 ug |
$425.00
|
|
SC118791 | ID2 (untagged)-Human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2) | 10 ug |
$225.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.