TM4SF2 (TSPAN7) (NM_004615) Human Tagged ORF Clone

SKU
RC205248
TSPAN7 (Myc-DDK-tagged)-Human tetraspanin 7 (TSPAN7)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TM4SF2
Synonyms A15; CCG-B7; CD231; DXS1692E; MRX58; MXS1; TALLA-1; TM4SF2; TM4SF2b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205248 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATCGAGGAGAATGGAGACCAAACCTGTGATAACCTGTCTCAAAACCCTCCTCATCATCTACTCCT
TCGTCTTCTGGATCACTGGGGTGATCCTGCTGGCTGTTGGAGTCTGGGGCAAACTTACTCTGGGCACCTA
TATCTCCCTTATTGCCAAGAACTCCACAAATGCTCCCTATGTGCTCATCGGAACTGGCACCACTATTGTT
GTCTTTGGCCTGTTTGGATGCTTTGCTACATGTCGTGGTAGCCCATGGATGCTGAAACTGTATGCCATGT
TTCTGTCCCTGGTGTTCCTGGCTGAGCTCGTAGCTGGCATTTCAGGGTTTGTGTTTCGTCATGAGATCAA
GGACACCTTCCTGAGGACTTACACGGACACTATGCAGACTTACAATGGCAATGATGAGAGGAGCCGGGCA
GTGGACCATGTGCAGCGCAGCCTGAGCTGCTGTGGTGTGCAGAACTACACCAACTGGAGCACCAGCCCCT
ACTTCCTGGAGCATGGCATCCCCCCCAGCTGCTGCATGAACGAAACTGATTGTAATCCCCAGGATCTACA
CAATCTGACTGTGGCCGCCACCAAAGTTAACCAGAAGGGTTGTTATGATCTGGTAACTAGTTTCATGGAG
ACTAACATGGGAATCATCGCTGGAGTGGCGTTTGGAATCGCATTCTCCCAGTTAATTGGCATGCTGCTGG
CCTGCTGTCTGTCCCGGTTCATCACGGCCAATCAGTATGAGATGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205248 protein sequence
Red=Cloning site Green=Tags(s)

MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAKNSTNAPYVLIGTGTTIV
VFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDTMQTYNGNDERSRA
VDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFME
TNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQYEMV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004615
ORF Size 747 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004615.4
RefSeq Size 1816 bp
RefSeq ORF 750 bp
Locus ID 7102
UniProt ID P41732
Cytogenetics Xp11.4
Domains transmembrane4
Protein Families Druggable Genome, Transmembrane
MW 27.6 kDa
Summary The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked cognitive disability and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TM4SF2 (TSPAN7) (NM_004615) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205248L1 Lenti ORF clone of Human tetraspanin 7 (TSPAN7), Myc-DDK-tagged 10 ug
$600.00
RC205248L2 Lenti ORF clone of Human tetraspanin 7 (TSPAN7), mGFP tagged 10 ug
$600.00
RC205248L3 Lenti ORF clone of Human tetraspanin 7 (TSPAN7), Myc-DDK-tagged 10 ug
$600.00
RC205248L4 Lenti ORF clone of Human tetraspanin 7 (TSPAN7), mGFP tagged 10 ug
$600.00
RG205248 TSPAN7 (tGFP-tagged) - Human tetraspanin 7 (TSPAN7) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC126663 TSPAN7 (untagged)-Human tetraspanin 7 (TSPAN7) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.