MMD (NM_012329) Human Tagged ORF Clone

SKU
RC205241
MMD (Myc-DDK-tagged)-Human monocyte to macrophage differentiation-associated (MMD)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MMD
Synonyms MMA; MMD1; PAQR11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205241 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGTTCAAGAATCGATTCCAGCGGTTCATGAACCATCGAGCTCCAGCCAATGGCCGCTACAAGCCAA
CTTGCTATGAACATGCTGCTAACTGTTACACACACGCATTCCTCATTGTTCCGGCCATCGTGGGCAGTGC
CCTCCTCCATCGGCTGTCTGATGACTGCTGGGAAAAGATAACAGCATGGATTTATGGAATGGGACTCTGT
GCCCTCTTCATCGTTTCTACAGTATTTCACATTGTATCATGGAAAAAGAGCCACTTAAGGACAGTGGAGC
ATTGTTTTCACATGTGTGATAGAATGGTTATCTATTTCTTCATTGCTGCTTCTTATGCTCCATGGTTAAA
TCTTCGTGAACTTGGACCCCTGGCATCTCATATGCGTTGGTTTATCTGGCTCATGGCAGCTGGAGGAACC
ATTTATGTATTTCTCTACCATGAAAAATATAAGGTGGTTGAACTCTTTTTCTATCTCACAATGGGATTCT
CTCCAGCCTTGGTGGTGACATCAATGAACAACACCGATGGACTTCAGGAACTTGCCTGTGGGGGCTTAAT
TTATTGCTTGGGAGTTGTGTTCTTCAAGAGTGATGGCATCATTCCATTTGCCCACGCCATCTGGCACCTG
TTTGTGGCCACGGCAGCTGCAGTGCATTACTACGCCATTTGGAAATACCTTTACCGAAGTCCTACGGACT
TTATGCGGCATTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205241 protein sequence
Red=Cloning site Green=Tags(s)

MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLC
ALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGT
IYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHL
FVATAAAVHYYAIWKYLYRSPTDFMRHL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012329
ORF Size 714 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012329.3
RefSeq Size 2723 bp
RefSeq ORF 717 bp
Locus ID 23531
UniProt ID Q15546
Cytogenetics 17q22
Domains UPF0073
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
MW 27.7 kDa
Summary This protein is expressed by in vitro differentiated macrophages but not freshly isolated monocytes. Although sequence analysis identifies seven potential transmembrane domains, this protein has little homology to G-protein receptors and it has not been positively identified as a receptor. A suggested alternative function is that of an ion channel protein in maturing macrophages. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MMD (NM_012329) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205241L3 Lenti ORF clone of Human monocyte to macrophage differentiation-associated (MMD), Myc-DDK-tagged 10 ug
$600.00
RC205241L4 Lenti ORF clone of Human monocyte to macrophage differentiation-associated (MMD), mGFP tagged 10 ug
$600.00
RG205241 MMD (tGFP-tagged) - Human monocyte to macrophage differentiation-associated (MMD) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111208 MMD (untagged)-Human monocyte to macrophage differentiation-associated (MMD) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.