LIM domain only 3 (LMO3) (NM_018640) Human Tagged ORF Clone

SKU
RC205190
LMO3 (Myc-DDK-tagged)-Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LIM domain only 3
Synonyms RBTN3; RBTNL2; Rhom-3; RHOM3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205190 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCTCAGTCCAGCCAGACACCAAGCCGAAAGGTTGTGCTGGCTGCAACCGAAAGATCAAGGACCGGT
ATCTTCTAAAGGCACTGGACAAATACTGGCATGAAGACTGCCTGAAGTGTGCCTGCTGTGACTGTCGCTT
GGGAGAGGTGGGCTCCACCCTGTACACTAAAGCTAATCTTATCCTTTGTCGCAGAGACTATCTGAGGCTC
TTTGGTGTAACGGGAAACTGCGCTGCCTGTAGTAAGCTCATCCCTGCCTTTGAGATGGTGATGCGTGCCA
AGGACAATGTTTACCACCTGGACTGCTTTGCATGTCAGCTTTGTAATCAGAGATTTTGTGTTGGAGACAA
ATTTTTCCTAAAGAATAACATGATCCTTTGCCAGACGGACTACGAGGAAGGTTTAATGAAAGAAGGTTAT
GCACCCCAGGTTCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205190 protein sequence
Red=Cloning site Green=Tags(s)

MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRL
FGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGY
APQVR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018640
ORF Size 435 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018640.5
RefSeq Size 3850 bp
RefSeq ORF 438 bp
Locus ID 55885
UniProt ID Q8TAP4
Cytogenetics 12p12.3
Domains LIM
Protein Families Transcription Factors
MW 16.6 kDa
Summary The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromosomal translocations in T-cell leukemia. Many alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:LIM domain only 3 (LMO3) (NM_018640) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205190L1 Lenti ORF clone of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC205190L2 Lenti ORF clone of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, mGFP tagged 10 ug
$450.00
RC205190L3 Lenti ORF clone of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC205190L4 Lenti ORF clone of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, mGFP tagged 10 ug
$450.00
RG205190 LMO3 (tGFP-tagged) - Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1 10 ug
$489.00
SC113402 LMO3 (untagged)-Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.