LIM domain only 3 (LMO3) (NM_018640) Human Tagged ORF Clone
SKU
RC205190
LMO3 (Myc-DDK-tagged)-Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | LIM domain only 3 |
Synonyms | RBTN3; RBTNL2; Rhom-3; RHOM3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC205190 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTCTCAGTCCAGCCAGACACCAAGCCGAAAGGTTGTGCTGGCTGCAACCGAAAGATCAAGGACCGGT ATCTTCTAAAGGCACTGGACAAATACTGGCATGAAGACTGCCTGAAGTGTGCCTGCTGTGACTGTCGCTT GGGAGAGGTGGGCTCCACCCTGTACACTAAAGCTAATCTTATCCTTTGTCGCAGAGACTATCTGAGGCTC TTTGGTGTAACGGGAAACTGCGCTGCCTGTAGTAAGCTCATCCCTGCCTTTGAGATGGTGATGCGTGCCA AGGACAATGTTTACCACCTGGACTGCTTTGCATGTCAGCTTTGTAATCAGAGATTTTGTGTTGGAGACAA ATTTTTCCTAAAGAATAACATGATCCTTTGCCAGACGGACTACGAGGAAGGTTTAATGAAAGAAGGTTAT GCACCCCAGGTTCGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205190 protein sequence
Red=Cloning site Green=Tags(s) MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRL FGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGY APQVR myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_018640 |
ORF Size | 435 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_018640.5 |
RefSeq Size | 3850 bp |
RefSeq ORF | 438 bp |
Locus ID | 55885 |
UniProt ID | Q8TAP4 |
Cytogenetics | 12p12.3 |
Domains | LIM |
Protein Families | Transcription Factors |
MW | 16.6 kDa |
Summary | The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromosomal translocations in T-cell leukemia. Many alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC205190L1 | Lenti ORF clone of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC205190L2 | Lenti ORF clone of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, mGFP tagged | 10 ug |
$450.00
|
|
RC205190L3 | Lenti ORF clone of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC205190L4 | Lenti ORF clone of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, mGFP tagged | 10 ug |
$450.00
|
|
RG205190 | LMO3 (tGFP-tagged) - Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1 | 10 ug |
$489.00
|
|
SC113402 | LMO3 (untagged)-Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1 | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.