SCAMP5 (NM_138967) Human Tagged ORF Clone

SKU
RC205149
SCAMP5 (Myc-DDK-tagged)-Human secretory carrier membrane protein 5 (SCAMP5), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SCAMP5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205149 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGAAAGTGAACAACTTCCCACCATTGCCCAAATTCATCCCGCTGAAGCCATGTTTCTACCAAG
ACTTCGAGGCAGATATTCCTCCCCAGCATGTCAGCATGACCAAGCGCCTCTACTACCTCTGGATGTTGAA
CAGCGTCACGCTGGCCGTGAACCTGGTGGGCTGTCTCGCGTGGCTGATCGGAGGCGGGGGAGCCACCAAC
TTTGGCCTCGCCTTTCTCTGGCTCATCCTCTTCACACCCTGCTCCTACGTCTGCTGGTTTCGGCCCATTT
ACAAGGCCTTCAAGACTGACAGCTCCTTCAGTTTCATGGCATTCTTCTTTACCTTCATGGCTCAGTTGGT
CATCAGCATCATCCAGGCCGTGGGCATCCCAGGCTGGGGCGTCTGCGGCTGGATTGCTACCATCTCCTTC
TTCGGAACGAACATTGGCTCGGCGGTGGTGATGCTAATTCCCACTGTCATGTTCACAGTGATGGCCGTCT
TTTCCTTCATCGCCCTCAGCATGGTTCATAAATTTTACCGGGGAAGTGGGGGGAGTTTCAGCAAAGCTCA
GGAGGAGTGGACCACAGGGGCCTGGAAGAATCCACATGTGCAGCAGGCAGCCCAGAACGCAGCCATGGGG
GCAGCCCAGGGTGCCATGAATCAGCCTCAGACTCAGTATTCCGCCACCCCCAATTACACGTACTCCAATG
AGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205149 protein sequence
Red=Cloning site Green=Tags(s)

MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATN
FGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISF
FGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMG
AAQGAMNQPQTQYSATPNYTYSNEM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138967
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138967.4
RefSeq Size 3433 bp
RefSeq ORF 708 bp
Locus ID 192683
UniProt ID Q8TAC9
Cytogenetics 15q24.2
Domains SCAMP
Protein Families Secreted Protein, Transmembrane
MW 26.1 kDa
Summary Required for the calcium-dependent exocytosis of signal sequence-containing cytokines such as CCL5. Probably acts in cooperation with the SNARE machinery. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT) in case of endoplasmic reticulum stress by inhibiting the endocytosis pathway.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SCAMP5 (NM_138967) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205149L3 Lenti ORF clone of Human secretory carrier membrane protein 5 (SCAMP5), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC205149L4 Lenti ORF clone of Human secretory carrier membrane protein 5 (SCAMP5), transcript variant 3, mGFP tagged 10 ug
$600.00
RG205149 SCAMP5 (tGFP-tagged) - Human secretory carrier membrane protein 5 (SCAMP5), transcript variant 3 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC120631 SCAMP5 (untagged)-Human secretory carrier membrane protein 5 (SCAMP5), transcript variant 3 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.