DNAJB9 (NM_012328) Human Tagged ORF Clone

SKU
RC205128
DNAJB9 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 9 (DNAJB9)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DNAJB9
Synonyms ERdj4; MDG-1; MDG1; MST049; MSTP049
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205128 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTACTCCCCAGTCAATTTTCATCTTTGCAATCTGCATTTTAATGATAACAGAATTAATTCTGGCCT
CAAAAAGCTACTATGATATCTTAGGTGTGCCAAAATCGGCATCAGAGCGCCAAATCAAGAAGGCCTTTCA
CAAGTTGGCCATGAAGTACCACCCTGACAAAAATAAGAGCCCGGATGCTGAAGCAAAATTCAGAGAGATT
GCAGAAGCATATGAAACACTCTCAGATGCTAATAGACGAAAAGAGTATGATACACTTGGACACAGTGCTT
TTACTAGTGGTAAAGGACAAAGAGGTAGTGGAAGTTCTTTTGAGCAGTCATTTAACTTCAATTTTGATGA
CTTATTTAAAGACTTTGGCTTTTTTGGTCAAAACCAAAACACTGGATCCAAGAAGCGTTTTGAAAATCAT
TTCCAGACACGCCAGGATGGTGGTTCCAGTAGACAAAGGCATCATTTCCAAGAATTTTCTTTTGGAGGTG
GATTATTTGATGACATGTTTGAAGATATGGAGAAAATGTTTTCTTTTAGTGGTTTTGACTCTACCAATCA
GCATACAGTACAGACTGAAAATAGATTTCATGGATCTAGCAAGCACTGCAGGACTGTCACTCAACGAAGA
GGAAATATGGTTACTACATACACTGACTGTTCAGGACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205128 protein sequence
Red=Cloning site Green=Tags(s)

MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREI
AEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENH
FQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRR
GNMVTTYTDCSGQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012328
ORF Size 669 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012328.3
RefSeq Size 2538 bp
RefSeq ORF 672 bp
Locus ID 4189
UniProt ID Q9UBS3
Cytogenetics 14q24.2-q24.3
Domains DnaJ
Protein Families Druggable Genome, Transmembrane
MW 25.5 kDa
Summary This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:DNAJB9 (NM_012328) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205128L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 9 (DNAJB9), Myc-DDK-tagged 10 ug
$600.00
RC205128L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 9 (DNAJB9), mGFP tagged 10 ug
$600.00
RC205128L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 9 (DNAJB9), Myc-DDK-tagged 10 ug
$600.00
RC205128L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 9 (DNAJB9), mGFP tagged 10 ug
$600.00
RG205128 DNAJB9 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily B, member 9 (DNAJB9) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC115412 DNAJB9 (untagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 9 (DNAJB9) 10 ug
$300.00
SC322545 DNAJB9 (untagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 9 (DNAJB9) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.