LSM8 (NM_016200) Human Tagged ORF Clone

SKU
RC205117
NAA38 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LSM8
Synonyms NAA38
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205117 representing NM_016200
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGTCCGCTTTGGAGAACTACATCAACCGAACTGTTGCCGTTATTACATCAGATGGGAGAATGATTG
TGGGAACACTGAAAGGTTTTGACCAGACCATTAATTTGATTTTGGATGAAAGCCATGAACGAGTATTCAG
CTCTTCACAGGGGGTAGAACAAGTGGTACTAGGATTATACATTGTAAGAGGTGACAACGTTGCAGTCATT
GGAGAAATCGATGAAGAAACAGATTCTGCGCTTGATTTGGGGAATATTCGAGCAGAACCTTTAAATTCTG
TAGCACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205117 representing NM_016200
Red=Cloning site Green=Tags(s)

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVI
GEIDEETDSALDLGNIRAEPLNSVAH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016200
ORF Size 288 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016200.5
RefSeq Size 12520 bp
RefSeq ORF 291 bp
Locus ID 51691
UniProt ID O95777
Cytogenetics 7q31.31
Domains Sm
Protein Pathways RNA degradation, Spliceosome
MW 10.4 kDa
Summary This gene encodes a member of the like-Sm family of proteins. The encoded protein consists of a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. This protein partners with six paralogs to form a heteroheptameric ring which transiently binds U6 small nuclear RNAs and is involved in the general maturation of RNA in the nucleus. [provided by RefSeq, Jan 2010]
Write Your Own Review
You're reviewing:LSM8 (NM_016200) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205117L3 Lenti-ORF clone of NAA38 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38) 10 ug
$450.00
RC205117L4 Lenti-ORF clone of NAA38 (mGFP-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38) 10 ug
$450.00
RG205117 NAA38 (tGFP-tagged) - Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38) 10 ug
$350.00
SC114417 NAA38 (untagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.