Claudin 20 (CLDN20) (NM_001001346) Human Tagged ORF Clone

SKU
RC205032
CLDN20 (Myc-DDK-tagged)-Human claudin 20 (CLDN20)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Claudin 20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205032 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCAGCAGGACTCCAGCTCCTTGCTTTCATCCTGGCCTTATCTGGGGTCTCTGGAGTGCTCACAG
CCACTCTGCTGCCCAACTGGAAGGTGAATGTGGATGTGGACTCCAACATCATAACAGCCATTGTACAGCT
GCACGGGCTCTGGATGGACTGTACGTGGTACAGCACTGGGATGTTCAGCTGTGCCCTGAAACACTCCATT
CTGTCCCTCCCCATCCACGTGCAGGCTGCGAGAGCCACCATGGTCCTGGCGTGTGTTCTGTCTGCTTTGG
GGATCTGCACTTCCACAGTAGGAATGAAATGTACTCGCTTAGGAGGGGACAGAGAAACCAAGAGCCATGC
TTCCTTTGCTGGAGGAGTCTGTTTCATGTCTGCAGGAATCTCTAGTTTAATCTCGACAGTGTGGTACACA
AAGGAGATCATAGCAAACTTTCTGGATCTGACAGTTCCAGAAAGCAACAAACATGAACCTGGAGGAGCTA
TCTATATCGGATTCATTTCTGCAATGCTGTTGTTTATCTCTGGCATGATTTTCTGCACCTCCTGTATAAA
AAGGAATCCAGAAGCTAGACTCGACCCACCCACACAGCAGCCTATCTCTAACACACAGCTCGAGAACAAT
TCCACACACAATCTGAAGGATTATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205032 protein sequence
Red=Cloning site Green=Tags(s)

MASAGLQLLAFILALSGVSGVLTATLLPNWKVNVDVDSNIITAIVQLHGLWMDCTWYSTGMFSCALKHSI
LSLPIHVQAARATMVLACVLSALGICTSTVGMKCTRLGGDRETKSHASFAGGVCFMSAGISSLISTVWYT
KEIIANFLDLTVPESNKHEPGGAIYIGFISAMLLFISGMIFCTSCIKRNPEARLDPPTQQPISNTQLENN
STHNLKDYV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001001346
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001001346.3
RefSeq Size 1209 bp
RefSeq ORF 660 bp
Locus ID 49861
UniProt ID P56880
Cytogenetics 6q25.3
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
MW 23.5 kDa
Summary This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:Claudin 20 (CLDN20) (NM_001001346) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205032L3 Lenti ORF clone of Human claudin 20 (CLDN20), Myc-DDK-tagged 10 ug
$600.00
RC205032L4 Lenti ORF clone of Human claudin 20 (CLDN20), mGFP tagged 10 ug
$600.00
RG205032 CLDN20 (tGFP-tagged) - Human claudin 20 (CLDN20) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319756 CLDN20 (untagged)-Human claudin 20 (CLDN20) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.