BTF3L4 (NM_152265) Human Tagged ORF Clone

SKU
RC205021
BTF3L4 (Myc-DDK-tagged)-Human basic transcription factor 3-like 4 (BTF3L4), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BTF3L4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205021 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCAAGAAAAGTTAGCCAAACTTCAGGCTCAGGTCCGGATAGGGGGCAAGGGTACAGCTCGCAGAA
AGAAGAAGGTGGTACATAGAACAGCCACAGCTGATGACAAAAAGCTTCAGAGTTCTCTAAAAAAACTGGC
TGTGAATAATATAGCTGGTATTGAAGAGGTGAACATGATTAAAGATGATGGGACAGTTATTCATTTCAAC
AATCCCAAAGTCCAAGCTTCCCTTTCTGCTAATACCTTTGCAATTACTGGTCATGCAGAAGCCAAACCAA
TCACAGAAATGCTTCCTGGAATATTAAGTCAGCTTGGTGCTGACAGTTTAACAAGCCTTAGGAAGTTAGC
TGAACAGTTCCCACGGCAAGTCTTGGACAGTAAAGCACCAAAACCAGAAGACATTGATGAGGAAGATGAT
GATGTTCCAGATCTTGTAGAAAATTTTGATGAGGCATCAAAGAATGAAGCTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205021 protein sequence
Red=Cloning site Green=Tags(s)

MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFN
NPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDD
DVPDLVENFDEASKNEAN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152265
ORF Size 474 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152265.5
RefSeq Size 4643 bp
RefSeq ORF 477 bp
Locus ID 91408
UniProt ID Q96K17
Cytogenetics 1p32.3
MW 17.3 kDa
Write Your Own Review
You're reviewing:BTF3L4 (NM_152265) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205021L3 Lenti ORF clone of Human basic transcription factor 3-like 4 (BTF3L4), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC205021L4 Lenti ORF clone of Human basic transcription factor 3-like 4 (BTF3L4), transcript variant 1, mGFP tagged 10 ug
$450.00
RG205021 BTF3L4 (tGFP-tagged) - Human basic transcription factor 3-like 4 (BTF3L4), transcript variant 1 10 ug
$489.00
SC306359 BTF3L4 (untagged)-Human basic transcription factor 3-like 4 (BTF3L4), transcript variant 1 10 ug
$165.00
SC320971 BTF3L4 (untagged)-Human basic transcription factor 3-like 4 (BTF3L4), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.