S100A10 (NM_002966) Human Tagged ORF Clone

SKU
RC204992
S100A10 (Myc-DDK-tagged)-Human S100 calcium binding protein A10 (S100A10)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol S100A10
Synonyms 42C; ANX2L; ANX2LG; CAL1L; Ca[1]; CLP11; GP11; p10; P11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204992 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCATCTCAAATGGAACACGCCATGGAAACCATGATGTTTACATTTCACAAATTCGCTGGGGATAAAG
GCTACTTAACAAAGGAGGACCTGAGAGTACTCATGGAAAAGGAGTTCCCTGGATTTTTGGAAAATCAAAA
AGACCCTCTGGCTGTGGACAAAATAATGAAGGACCTGGACCAGTGTAGAGATGGCAAAGTGGGCTTCCAG
AGCTTCTTTTCCCTAATTGCGGGCCTCACCATTGCATGCAATGACTATTTTGTAGTACACATGAAGCAGA
AGGGAAAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204992 protein sequence
Red=Cloning site Green=Tags(s)

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQ
SFFSLIAGLTIACNDYFVVHMKQKGKK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002966
ORF Size 291 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002966.3
RefSeq Size 1069 bp
RefSeq ORF 294 bp
Locus ID 6281
UniProt ID P60903
Cytogenetics 1q21.3
Domains S_100
Protein Families Transmembrane
MW 11.2 kDa
Summary The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:S100A10 (NM_002966) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204992L1 Lenti ORF clone of Human S100 calcium binding protein A10 (S100A10), Myc-DDK-tagged 10 ug
$450.00
RC204992L2 Lenti ORF clone of Human S100 calcium binding protein A10 (S100A10), mGFP tagged 10 ug
$450.00
RC204992L3 Lenti ORF clone of Human S100 calcium binding protein A10 (S100A10), Myc-DDK-tagged 10 ug
$450.00
RC204992L4 Lenti ORF clone of Human S100 calcium binding protein A10 (S100A10), mGFP tagged 10 ug
$450.00
RG204992 S100A10 (tGFP-tagged) - Human S100 calcium binding protein A10 (S100A10) 10 ug
$489.00
SC118303 S100A10 (untagged)-Human S100 calcium binding protein A10 (S100A10) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.