CDC42EP2 (NM_006779) Human Tagged ORF Clone

SKU
RC204974
CDC42EP2 (Myc-DDK-tagged)-Human CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CDC42EP2
Synonyms BORG1; CEP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204974 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACCAAGGTGCCCATCTATCTGAAGCGTGGCAGTCGCAAGGGCAAGAAGGAGAAGCTTCGGGACC
TGCTGTCCTCGGACATGATCAGCCCACCGCTGGGGGACTTCCGCCACACCATTCATATTGGCAGTGGCGG
CGGCAGTGACATGTTTGGCGACATCTCCTTCCTGCAGGGCAAGTTCCACCTCCTGCCGGGGACCATGGTG
GAGGGGCCTGAAGAAGATGGCACCTTCGACCTCCCCTTCCAGTTCACCCGCACCGCCACCGTGTGTGGGC
GGGAGCTCCCGGACGGCCCATCCCCTCTGCTCAAGAACGCCATCTCCCTCCCGGTTATCGGTGGACCCCA
GGCTCTCACCCTGCCCACAGCCCAGGCTCCACCCAAGCCCCCTCGCCTGCACCTGGAGACCCCTCAGCCT
TCCCCACAGGAGGGAGGGAGTGTGGACATCTGGAGGATTCCAGAGACTGGCTCCCCCAACAGTGGACTGA
CCCCGGAGTCAGGGGCCGAGGAGCCCTTCCTGTCCAATGCCAGCTCCCTGCTGTCCCTGCACGTGGACCT
GGGGCCTTCCATCCTGGATGATGTCCTGCAGATCATGGATCAGGACCTGGACAGCATGCAGATCCCCACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204974 protein sequence
Red=Cloning site Green=Tags(s)

MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMV
EGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQP
SPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006779
ORF Size 630 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006779.4
RefSeq Size 2043 bp
RefSeq ORF 633 bp
Locus ID 10435
UniProt ID O14613
Cytogenetics 11q13.1
Domains PBD
MW 22.5 kDa
Summary CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of CDC42. Coexpression of this protein with CDC42 suggested a role of this protein in actin filament assembly and cell shape control. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:CDC42EP2 (NM_006779) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204974L3 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2), Myc-DDK-tagged 10 ug
$600.00
RC204974L4 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2), mGFP tagged 10 ug
$600.00
RG204974 CDC42EP2 (tGFP-tagged) - Human CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC115843 CDC42EP2 (untagged)-Human CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2) 10 ug
$300.00
SC324516 CDC42EP2 (untagged)-Human CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.