SEC11A (NM_014300) Human Tagged ORF Clone

SKU
RC204971
SEC11A (Myc-DDK-tagged)-Human SEC11 homolog A (S. cerevisiae) (SEC11A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SEC11A
Synonyms 1810012E07Rik; SEC11L1; sid2895; SPC18; SPCS4A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204971 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCTCTAGACTTTTTGGACGATGTGCGGCGGATGAACAAGCGGCAGCTCTATTATCAAGTCCTAA
ATTTTGGAATGATTGTCTCATCGGCACTAATGATCTGGAAGGGGTTAATGGTAATAACTGGAAGTGAAAG
TCCGATTGTAGTGGTGCTCAGTGGCAGCATGGAACCTGCATTTCATAGAGGAGATCTTCTCTTTCTAACA
AATCGAGTTGAAGATCCCATACGAGTGGGAGAAATTGTTGTTTTTAGGATAGAAGGAAGAGAGATTCCTA
TAGTTCACCGAGTCTTGAAGATTCATGAAAAGCAAAATGGGCATATCAAGTTTTTGACCAAAGGAGATAA
TAATGCGGTTGATGACCGAGGCCTCTATAAACAAGGACAACATTGGCTAGAGAAAAAAGATGTTGTGGGG
AGAGCCAGGGGATTTGTTCCTTATATTGGAATTGTGACGATCCTCATGAATGACTATCCTAAATTTAAGT
ATGCAGTTCTCTTTTTGCTGGGTTTATTCGTGCTGGTTCATCGTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204971 protein sequence
Red=Cloning site Green=Tags(s)

MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLT
NRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVG
RARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014300
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014300.4
RefSeq Size 1424 bp
RefSeq ORF 540 bp
Locus ID 23478
UniProt ID P67812
Cytogenetics 15q25.2-q25.3
Domains Peptidase_S26
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Protein export
MW 20.6 kDa
Summary This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:SEC11A (NM_014300) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204971L1 Lenti ORF clone of Human SEC11 homolog A (S. cerevisiae) (SEC11A), Myc-DDK-tagged 10 ug
$600.00
RC204971L2 Lenti ORF clone of Human SEC11 homolog A (S. cerevisiae) (SEC11A), mGFP tagged 10 ug
$600.00
RC204971L3 Lenti ORF clone of Human SEC11 homolog A (S. cerevisiae) (SEC11A), Myc-DDK-tagged 10 ug
$600.00
RC204971L4 Lenti ORF clone of Human SEC11 homolog A (S. cerevisiae) (SEC11A), mGFP tagged 10 ug
$600.00
RG204971 SEC11A (tGFP-tagged) - Human SEC11 homolog A (S. cerevisiae) (SEC11A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC115102 SEC11A (untagged)-Human SEC11 homolog A (S. cerevisiae) (SEC11A) 10 ug
$300.00
SC320451 SEC11A (untagged)-Human SEC11 homolog A (S. cerevisiae) (SEC11A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.