PROCR (NM_006404) Human Tagged ORF Clone

SKU
RC204858
PROCR (Myc-DDK-tagged)-Human protein C receptor, endothelial (PROCR)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PROCR
Synonyms CCCA; CCD41; EPCR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204858 representing NM_006404.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGTTGACAACATTGCTGCCGATACTGCTGCTGTCTGGCTGGGCCTTTTGTAGCCAAGACGCCTCAGAT
GGCCTCCAAAGACTTCATATGCTCCAGATCTCCTACTTCCGCGACCCCTATCACGTGTGGTACCAGGGC
AACGCGTCGCTGGGGGGACACCTAACGCACGTGCTGGAAGGCCCAGACACCAACACCACGATCATTCAG
CTGCAGCCCTTGCAGGAGCCCGAGAGCTGGGCGCGCACGCAGAGTGGCCTGCAGTCCTACCTGCTCCAG
TTCCACGGCCTCGTGCGCCTGGTGCACCAGGAGCGGACCTTGGCCTTTCCTCTGACCATCCGCTGCTTC
CTGGGCTGTGAGCTGCCTCCCGAGGGCTCTAGAGCCCATGTCTTCTTCGAAGTGGCTGTGAATGGGAGC
TCCTTTGTGAGTTTCCGGCCGGAGAGAGCCTTGTGGCAGGCAGACACCCAGGTCACCTCCGGAGTGGTC
ACCTTCACCCTGCAGCAGCTCAATGCCTACAACCGCACTCGGTATGAACTGCGGGAATTCCTGGAGGAC
ACCTGTGTGCAGTATGTGCAGAAACATATTTCCGCGGAAAACACGAAAGGGAGCCAAACAAGCCGCTCC
TACACTTCGCTGGTCCTGGGCGTCCTGGTGGGCGGTTTCATCATTGCTGGTGTGGCTGTAGGCATCTTC
CTGTGCACAGGTGGACGGCGATGT

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
ATCCTGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>Peptide sequence encoded by RC204858
Blue=ORF Red=Cloning site Green=Tag(s)

MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQ
LQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGS
SFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRS
YTSLVLGVLVGGFIIAGVAVGIFLCTGGRRC

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_006404
ORF Size 714 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006404.2
RefSeq Size 1506 bp
RefSeq ORF 717 bp
Locus ID 10544
UniProt ID Q9UNN8
Cytogenetics 20q11.22
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
MW 26.6 kDa
Summary The protein encoded by this gene is a receptor for activated protein C, a serine protease activated by and involved in the blood coagulation pathway. The encoded protein is an N-glycosylated type I membrane protein that enhances the activation of protein C. Mutations in this gene have been associated with venous thromboembolism and myocardial infarction, as well as with late fetal loss during pregnancy. The encoded protein may also play a role in malarial infection and has been associated with cancer. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:PROCR (NM_006404) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204858L1 Lenti ORF clone of Human protein C receptor, endothelial (PROCR), Myc-DDK-tagged 10 ug
$600.00
RC204858L2 Lenti ORF clone of Human protein C receptor, endothelial (PROCR), mGFP tagged 10 ug
$600.00
RC204858L3 Lenti ORF clone of Human protein C receptor, endothelial (PROCR), Myc-DDK-tagged 10 ug
$600.00
RC204858L4 Lenti ORF clone of Human protein C receptor, endothelial (PROCR), mGFP tagged 10 ug
$600.00
RG204858 PROCR (tGFP-tagged) - Human protein C receptor, endothelial (PROCR) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC321462 PROCR (untagged)-Human protein C receptor, endothelial (PROCR) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.